Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139644 799 bp mRNA linear INV 09-DEC-2024 (LOC108056033), mRNA. ACCESSION XM_017139644 VERSION XM_017139644.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139644.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..799 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..799 /gene="LOC108056033" /note="uncharacterized LOC108056033; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056033" CDS 164..604 /gene="LOC108056033" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016995133.2" /db_xref="GeneID:108056033" /translation="MLRIRSVDHVLLIVLAAVAFVAAKQESASRQFGGQNFGNNLGPS FGSSGAGGFGGLGPGSGAAGFPGQGYGPPIQQPPIQQPGCPLCDSSVYSYCSHKMVHD ACCCDFPAAQLRPPQCLYYDCSLLYAKSCYEHALIKNCCCNNPY" polyA_site 799 /gene="LOC108056033" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagacaagcg tccgccactc gatcgctggt tttataaagg tttcctttgt tgcagtccac 61 attcggcagt gccagcatca gcatcatcac tcggcaccca gacactcgtc actcgaattt 121 ttgttccagg aaagataaac aaaatacccc caaggaatcc cagatgttgc gcatacgcag 181 tgtggaccac gttctactga tcgttctggc ggcagtcgct tttgtggcgg caaaacaaga 241 gagtgcatcg cgtcaatttg gcggtcagaa cttcggcaac aacctgggtc cctccttcgg 301 gtcatcgggg gccgggggtt tcggtggact gggacctggt tccggagctg ccggatttcc 361 gggacagggc tacggaccac cgatacaaca gcctccgatt caacagcctg gctgcccgct 421 gtgcgactcg tcggtctact cctactgctc ccacaagatg gtccacgatg cctgttgctg 481 cgattttcca gcagcgcagt tgcgacctcc ccagtgtttg tactacgact gctcgctgct 541 gtatgccaaa tcctgttacg aacacgccct catcaagaac tgctgctgca ataatcccta 601 ctgacgcaga aatatgggat atggacgtat cgtagagcgc agccaagtga tttgtttgct 661 taatttattt attcaatacc aatcccaatc gcaatccatt taaaatgcat gtgcatgtgc 721 gccgcgaaca gattaatttt taaatcaaat tcttgcgacg ctaaattaaa ttaaattaag 781 taaattattt gaaacgtta