Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017139644             799 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056033), mRNA.
ACCESSION   XM_017139644
VERSION     XM_017139644.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139644.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..799
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..799
                     /gene="LOC108056033"
                     /note="uncharacterized LOC108056033; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056033"
     CDS             164..604
                     /gene="LOC108056033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016995133.2"
                     /db_xref="GeneID:108056033"
                     /translation="MLRIRSVDHVLLIVLAAVAFVAAKQESASRQFGGQNFGNNLGPS
                     FGSSGAGGFGGLGPGSGAAGFPGQGYGPPIQQPPIQQPGCPLCDSSVYSYCSHKMVHD
                     ACCCDFPAAQLRPPQCLYYDCSLLYAKSCYEHALIKNCCCNNPY"
     polyA_site      799
                     /gene="LOC108056033"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagacaagcg tccgccactc gatcgctggt tttataaagg tttcctttgt tgcagtccac
       61 attcggcagt gccagcatca gcatcatcac tcggcaccca gacactcgtc actcgaattt
      121 ttgttccagg aaagataaac aaaatacccc caaggaatcc cagatgttgc gcatacgcag
      181 tgtggaccac gttctactga tcgttctggc ggcagtcgct tttgtggcgg caaaacaaga
      241 gagtgcatcg cgtcaatttg gcggtcagaa cttcggcaac aacctgggtc cctccttcgg
      301 gtcatcgggg gccgggggtt tcggtggact gggacctggt tccggagctg ccggatttcc
      361 gggacagggc tacggaccac cgatacaaca gcctccgatt caacagcctg gctgcccgct
      421 gtgcgactcg tcggtctact cctactgctc ccacaagatg gtccacgatg cctgttgctg
      481 cgattttcca gcagcgcagt tgcgacctcc ccagtgtttg tactacgact gctcgctgct
      541 gtatgccaaa tcctgttacg aacacgccct catcaagaac tgctgctgca ataatcccta
      601 ctgacgcaga aatatgggat atggacgtat cgtagagcgc agccaagtga tttgtttgct
      661 taatttattt attcaatacc aatcccaatc gcaatccatt taaaatgcat gtgcatgtgc
      721 gccgcgaaca gattaatttt taaatcaaat tcttgcgacg ctaaattaaa ttaaattaag
      781 taaattattt gaaacgtta