Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii glycine-rich selenoprotein


LOCUS       XM_017139643             711 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056032), mRNA.
ACCESSION   XM_017139643
VERSION     XM_017139643.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139643.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..711
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..711
                     /gene="LOC108056032"
                     /note="glycine-rich selenoprotein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:108056032"
     CDS             140..484
                     /gene="LOC108056032"
                     /codon_start=1
                     /product="glycine-rich selenoprotein"
                     /protein_id="XP_016995132.2"
                     /db_xref="GeneID:108056032"
                     /translation="MAYVDQSGRLWEKRPWDMNRVLALFVGIWFAIKQLFVSFLAPFS
                     GNDNNGDNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGYGGGGLRPNRRIGRIPP
                     PSQSCSAGGCCG"
     misc_feature    143..>322
                     /gene="LOC108056032"
                     /note="Selenoprotein SelK_SelG; Region: SelK_SelG;
                     pfam10961"
                     /db_xref="CDD:463198"
     polyA_site      711
                     /gene="LOC108056032"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcagctgctt tgttcgccca tccctaaaca ccacgtcaag tatataattt tgtatacaat
       61 cttaaaaatt ttgtttcggt tccagattgg aaatatttca ggaaatcgac aaggtcttgc
      121 acgctgattg ggctgcatta tggcgtacgt ggatcaaagt ggacgcctct gggagaagcg
      181 tccttgggac atgaatcgtg ttttggccct attcgtgggc atctggttcg ccatcaagca
      241 gttattcgta tcgttcctgg ctccattcag cggtaacgac aacaacggtg ataactcccg
      301 tcgcggaaat ggatggggaa gtagcagctg gggcggagga ggcggtggag gaggtggtgg
      361 tggtggcgga ggtggcggtg gaggaggcgg tggttatggc ggaggaggac tacgaccaaa
      421 ccgacgaatt gggcgcatac caccgccctc ccaatcctgc agtgccggag gatgctgcgg
      481 ttagacaatt attcaaagca ttttggccct aagaactgca aaaccaaaat actacactac
      541 tttactttgg aacacccatc tcaccgccgt gatgcagcaa ctaaagttta taactttctg
      601 tttcaaatat atattataac tcggttttag acataaggtg ggggattcac gaagcaagac
      661 tcgaaacggc ataatattgt ccaataaact tcctagtttc tcaactcaca a