Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139643 711 bp mRNA linear INV 09-DEC-2024 (LOC108056032), mRNA. ACCESSION XM_017139643 VERSION XM_017139643.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139643.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..711 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..711 /gene="LOC108056032" /note="glycine-rich selenoprotein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108056032" CDS 140..484 /gene="LOC108056032" /codon_start=1 /product="glycine-rich selenoprotein" /protein_id="XP_016995132.2" /db_xref="GeneID:108056032" /translation="MAYVDQSGRLWEKRPWDMNRVLALFVGIWFAIKQLFVSFLAPFS GNDNNGDNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGYGGGGLRPNRRIGRIPP PSQSCSAGGCCG" misc_feature 143..>322 /gene="LOC108056032" /note="Selenoprotein SelK_SelG; Region: SelK_SelG; pfam10961" /db_xref="CDD:463198" polyA_site 711 /gene="LOC108056032" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcagctgctt tgttcgccca tccctaaaca ccacgtcaag tatataattt tgtatacaat 61 cttaaaaatt ttgtttcggt tccagattgg aaatatttca ggaaatcgac aaggtcttgc 121 acgctgattg ggctgcatta tggcgtacgt ggatcaaagt ggacgcctct gggagaagcg 181 tccttgggac atgaatcgtg ttttggccct attcgtgggc atctggttcg ccatcaagca 241 gttattcgta tcgttcctgg ctccattcag cggtaacgac aacaacggtg ataactcccg 301 tcgcggaaat ggatggggaa gtagcagctg gggcggagga ggcggtggag gaggtggtgg 361 tggtggcgga ggtggcggtg gaggaggcgg tggttatggc ggaggaggac tacgaccaaa 421 ccgacgaatt gggcgcatac caccgccctc ccaatcctgc agtgccggag gatgctgcgg 481 ttagacaatt attcaaagca ttttggccct aagaactgca aaaccaaaat actacactac 541 tttactttgg aacacccatc tcaccgccgt gatgcagcaa ctaaagttta taactttctg 601 tttcaaatat atattataac tcggttttag acataaggtg ggggattcac gaagcaagac 661 tcgaaacggc ataatattgt ccaataaact tcctagtttc tcaactcaca a