Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii gamma-aminobutyric acid receptor


LOCUS       XM_017139642            1851 bp    mRNA    linear   INV 09-DEC-2024
            subunit alpha-6 (LOC108056031), mRNA.
ACCESSION   XM_017139642
VERSION     XM_017139642.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139642.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1851
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1851
                     /gene="LOC108056031"
                     /note="gamma-aminobutyric acid receptor subunit alpha-6;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 10 Proteins"
                     /db_xref="GeneID:108056031"
     CDS             232..1824
                     /gene="LOC108056031"
                     /codon_start=1
                     /product="gamma-aminobutyric acid receptor subunit
                     alpha-6"
                     /protein_id="XP_016995131.2"
                     /db_xref="GeneID:108056031"
                     /translation="MTARSMNNRTRGYFPESLHHQSRRVSRKASSADMLSRNISMILE
                     NLLKRYEQSQLPTHGQGVPTVVQTNILIRSMGPVSELDMDYSMDCYFRQYWRDKRLSF
                     KGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGGILYSMRLTI
                     KATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLIS
                     MMHRNSTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATS
                     DRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYFT
                     KLGSGESPQLEDQWEDIAHSSLSDQAADGDGDGDPDPDSDSSEGTENEGAASESICAC
                     SQKHDALGLEYEVSLQNSLAGAGFLKRNAIFCPTYNDPSYILPNTMERTTQTEPPAVS
                     RLHQMWMCLKSDNSFRRQRERNAAAQKSEQGGANCYVNSVSLIDRVARIAFPMSFAFL
                     NLLYWWAYGMYKKEFSWSNMKA"
     misc_feature    271..1779
                     /gene="LOC108056031"
                     /note="Cation transporter family protein; Region: LIC;
                     cl42365"
                     /db_xref="CDD:455710"
     misc_feature    418..966
                     /gene="LOC108056031"
                     /note="gamma-aminobutyric acid receptor subunit alpha-like
                     extracellular domain in protostomia, such as GRD
                     (GABA/glycine-like receptor of Drosophila); Region:
                     LGIC_ECD_GABAR_GRD-like; cd19007"
                     /db_xref="CDD:349808"
     misc_feature    order(442..444,499..501)
                     /gene="LOC108056031"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:349808"
     misc_feature    order(451..453,457..462,475..480,499..501,505..510,
                     559..561,565..570,595..612,619..621,625..627,631..636,
                     652..660,664..666,694..702,784..786,964..966)
                     /gene="LOC108056031"
                     /note="pentamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:349808"
     misc_feature    721..765
                     /gene="LOC108056031"
                     /note="Cys-loop [structural motif]; Region: Cys-loop"
                     /db_xref="CDD:349808"
ORIGIN      
        1 gcaatcaata aaagtgggca aacagtcgat tgattttata attcctgcac tctggggcga
       61 aaagtgaatg aactagaaca tctacttttc aggattttca tctactgcat ttgtataggc
      121 gtagggaata gtactatcca gtcgccaact tcatcggatc ttctctatat caatatcaaa
      181 ataccgaata taactaatga gttcagttcg aggattttca attcagttca aatgacagct
      241 cgatcgatga acaacagaac tcgcggttat ttccctgaat ccctccacca tcaaagtcgt
      301 cgagtttcgc gaaaggcctc atcggccgat atgctgagtc gcaacatatc gatgatactg
      361 gagaacctgc tcaagcgcta cgagcaatcg caactgccca ctcatggaca gggcgttccg
      421 acggtggtcc agaccaatat actaatccgc agcatgggtc ccgtttcgga actggacatg
      481 gactactcga tggactgcta cttcaggcag tattggcggg acaagcggct gagcttcaag
      541 ggacccatca agagcctgtc gctcagcatc aaaatgctcg acaagatttg gcggccggac
      601 acgtatttct acaacgggaa gcactcacag attcacatga ttactgtgcc caacaaattg
      661 ctgcgactgg accaaaacgg aggcattctc tattcaatgc gattaacaat caaagccact
      721 tgtcccatgg agctgcaaaa ctttcccatg gaccggcaat cctgtcccct tgtcatcgga
      781 agctatggtt atataaacca acagctaata tatgaatgga aaaaccaaga tgatgccgtt
      841 tcctttgttc cgggaatgac tttaaatcaa ttcgatctca tcagcatgat gcatcgcaat
      901 tctacaactg tgcgacgcga aggtgacttt tcggtcttgc atgtagcgtt taatctgaag
      961 cgtcatactg gatatttcct gattcaagtg tatgtgccct gcatactgat cgtggttttg
     1021 tcctgggtct ccttttggat acatcgcgag gccacgagcg accgggtcag tttgtgcgtg
     1081 acctccgtcc tgaccctatc taccattagc ttggactcgc gaaccgattt gcccaaagtc
     1141 aagtatgcca ccgccctgga ttggtttctc ctgatgagct tcctctactg cattgccaca
     1201 ctgttggaat ttgccggcgt tcactacttc acgaaacttg gaagcggaga gagtccgcaa
     1261 ctggaggatc agtgggagga tatagctcat agctcactat cggatcaagc agctgatggg
     1321 gatggggatg gtgatcctga tcctgactcg gactcgagtg aaggtaccga gaacgagggg
     1381 gcggcgagtg aatcgatttg tgcctgcagc caaaaacacg atgctcttgg tctcgaatat
     1441 gaggtctcat tgcaaaactc attggccggc gctggttttc tcaagcgcaa tgccatcttc
     1501 tgtccaacat ataatgaccc atcgtatata ctgccgaaca ccatggagag aaccactcaa
     1561 acggagccgc cggcggtttc ccgattgcac cagatgtgga tgtgcctgaa gagcgacaac
     1621 agtttccgga ggcaacggga acgcaacgcg gcggcccaga agagcgaaca gggaggcgcc
     1681 aactgctatg tgaatagtgt gtccctgatc gatcgagtgg cacgaatcgc cttccccatg
     1741 tcctttgcct ttctcaacct gctgtactgg tgggcctacg gaatgtataa aaaggagttc
     1801 tcatggtcca acatgaaggc atagacacga tgaataaatg tctataacaa t