Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017139637             678 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056027), mRNA.
ACCESSION   XM_017139637
VERSION     XM_017139637.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139637.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..678
                     /gene="LOC108056027"
                     /note="uncharacterized LOC108056027; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056027"
     CDS             170..571
                     /gene="LOC108056027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016995126.2"
                     /db_xref="GeneID:108056027"
                     /translation="MNTLKSDDKPFNPFYIGPHPSKACAIPEIPGRQCSPSCQPPEGQ
                     AAASSAPSDGHQPTDAQSVPSGAAGGMLIVGVANIYSTVEVLAAAARMGEAGGTGAAG
                     AAHQAPSAPNKTICKPYPCMEGARTESPGCD"
     polyA_site      678
                     /gene="LOC108056027"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggacattcgt tcagttttgg ggccaatctc acatagagca gttcgggaaa ctagctaaaa
       61 ttcaaaattt gtccgtgtgg ataactctgt gttttttcac cctttttttg ccgttcatcg
      121 ttttccgttt ttaccgccgc cgccgccata tcgccaaata gccatcgtca tgaacactct
      181 taagtcggac gacaagccct tcaatccctt ctacattggc ccgcatccca gcaaggcctg
      241 tgcgatcccc gagattcccg gccgtcaatg ttcgcccagc tgccagccgc cggagggcca
      301 ggcggctgca agttccgcac cttcagatgg ccatcagccg acggatgccc agagcgtccc
      361 gagcggagct gcgggcggca tgctaatcgt gggcgtggcc aatatataca gcacagtgga
      421 ggtcctggct gccgccgctc gaatgggaga ggcgggcgga acgggggcgg caggagcggc
      481 tcatcaggct ccttcggcgc ccaacaaaac catatgcaag ccgtatccct gcatggaggg
      541 cgctcgcact gaaagtcctg gctgtgatta aaaccggagg aaattcacgc aggatcaacg
      601 atcaatcagg actacttcta cctaaattag ccccaaatac ttgaataaaa actaggaaaa
      661 tccaaaaaaa acggaaaa