Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139624 1387 bp mRNA linear INV 09-DEC-2024 1 (Rcd-1), mRNA. ACCESSION XM_017139624 VERSION XM_017139624.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139624.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1387 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1387 /gene="Rcd-1" /note="Required for cell differentiation 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108056018" CDS 255..1148 /gene="Rcd-1" /codon_start=1 /product="CCR4-NOT transcription complex subunit 9" /protein_id="XP_016995113.1" /db_xref="GeneID:108056018" /translation="MSAQPSPLMNPQQQQQSEQEKVYQWINELAHPDTRETALLELSK KRETDLAPMLWNSFGTACALLQEIVNIYPSITPPTLTAHQSNRVCNALALLQCVASHP ETRTAFLQAQIPLYLYPFLSTTSKTRPFEYLRLTSLGVIGALVKTDEQEVITFLLTTE IVPLCLSIMDSGSELSKTVATFIIQKILLDESGLSYICQTYERFSHVAITLGKMVIQL SKDPCARLLKHVVRCYLRLSDNTRARKALGQCLPDQLRDGTFALCLQDDKSTKQWLQM LLKNLELGVTPQQIGMSPLGS" misc_feature 327..1097 /gene="Rcd-1" /note="Cell differentiation family, Rcd1-like; Region: Rcd1; pfam04078" /db_xref="CDD:461160" polyA_site 1387 /gene="Rcd-1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtttgccttg gtccaccact aatctgaatc tgtgcaagtc gccacttgtt ttcttttccc 61 tctttttaaa cttgaaccga cacgatttgg gtgccagaaa gcgacgccac gccattttgc 121 gattcccccg attccgtgcc gcccgttgag attacatccc aggcagcaaa ccgcccggcg 181 aaagtagaga gcaacgaaat ccgaatcata atcctcgcaa gcttcttcgc tgattcttca 241 attctcgctt tgcaatgagt gcgcagccca gtccgctgat gaatccccag cagcagcagc 301 agagtgagca ggagaaggtc taccagtgga tcaacgagct ggcccatccg gacacccgcg 361 agacggcgct gctggagctg agcaagaagc gcgagaccga tttggcgccc atgctgtgga 421 acagctttgg taccgcctgc gcgctgctcc aggagatcgt caatatatat ccctcgataa 481 cgccgcccac tctgacggcc catcagtcga atcgcgtgtg caacgccctg gctttgctgc 541 agtgcgtcgc ctcgcatccg gagacgcgca cggccttcct gcaggcccag atacccctgt 601 acctttaccc ctttctctcg accacctcga agaccaggcc cttcgagtac ctgcgtctca 661 ccagtctggg cgtcattgga gccctagtta agaccgacga acaggaggtg atcaccttcc 721 tgctgaccac cgagatcgtg cccttgtgcc tcagcatcat ggacagcggc tcggagctga 781 gcaagaccgt ggccactttc attatccaga agatcttgct cgacgagtcc ggtttgtcgt 841 acatctgcca gacctacgaa cgcttctcgc atgtggccat caccttgggc aaaatggtca 901 tccagctgtc gaaggacccg tgtgctcgcc tcctgaagca tgtggtgcgt tgctatctgc 961 gcctctcgga caacactcgc gctcgcaaag ccttgggcca gtgcctgccg gaccaactgc 1021 gcgacgggac cttcgctctg tgcctgcagg acgacaagtc caccaagcag tggctgcaga 1081 tgctgctcaa gaacctcgag ctgggcgtca caccgcagca gatcggcatg tcgccgctgg 1141 gctcttagat agctaaagct gcaccacttc caagtattgc caaggcaatc caacaatcca 1201 acatccaact ggttagctgc ccgaccgaat aatatattta ataagcttgc acaagattga 1261 ttgcctgtgt ctaacctaag cagagctgta atataataac taaacataaa caaagtaccg 1321 ataaagtaat gttaatacta agtttgtcac tgatactgat agcaaataaa gaacctcaag 1381 cagacga