Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Required for cell differentiation


LOCUS       XM_017139624            1387 bp    mRNA    linear   INV 09-DEC-2024
            1 (Rcd-1), mRNA.
ACCESSION   XM_017139624
VERSION     XM_017139624.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139624.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1387
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1387
                     /gene="Rcd-1"
                     /note="Required for cell differentiation 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:108056018"
     CDS             255..1148
                     /gene="Rcd-1"
                     /codon_start=1
                     /product="CCR4-NOT transcription complex subunit 9"
                     /protein_id="XP_016995113.1"
                     /db_xref="GeneID:108056018"
                     /translation="MSAQPSPLMNPQQQQQSEQEKVYQWINELAHPDTRETALLELSK
                     KRETDLAPMLWNSFGTACALLQEIVNIYPSITPPTLTAHQSNRVCNALALLQCVASHP
                     ETRTAFLQAQIPLYLYPFLSTTSKTRPFEYLRLTSLGVIGALVKTDEQEVITFLLTTE
                     IVPLCLSIMDSGSELSKTVATFIIQKILLDESGLSYICQTYERFSHVAITLGKMVIQL
                     SKDPCARLLKHVVRCYLRLSDNTRARKALGQCLPDQLRDGTFALCLQDDKSTKQWLQM
                     LLKNLELGVTPQQIGMSPLGS"
     misc_feature    327..1097
                     /gene="Rcd-1"
                     /note="Cell differentiation family, Rcd1-like; Region:
                     Rcd1; pfam04078"
                     /db_xref="CDD:461160"
     polyA_site      1387
                     /gene="Rcd-1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtttgccttg gtccaccact aatctgaatc tgtgcaagtc gccacttgtt ttcttttccc
       61 tctttttaaa cttgaaccga cacgatttgg gtgccagaaa gcgacgccac gccattttgc
      121 gattcccccg attccgtgcc gcccgttgag attacatccc aggcagcaaa ccgcccggcg
      181 aaagtagaga gcaacgaaat ccgaatcata atcctcgcaa gcttcttcgc tgattcttca
      241 attctcgctt tgcaatgagt gcgcagccca gtccgctgat gaatccccag cagcagcagc
      301 agagtgagca ggagaaggtc taccagtgga tcaacgagct ggcccatccg gacacccgcg
      361 agacggcgct gctggagctg agcaagaagc gcgagaccga tttggcgccc atgctgtgga
      421 acagctttgg taccgcctgc gcgctgctcc aggagatcgt caatatatat ccctcgataa
      481 cgccgcccac tctgacggcc catcagtcga atcgcgtgtg caacgccctg gctttgctgc
      541 agtgcgtcgc ctcgcatccg gagacgcgca cggccttcct gcaggcccag atacccctgt
      601 acctttaccc ctttctctcg accacctcga agaccaggcc cttcgagtac ctgcgtctca
      661 ccagtctggg cgtcattgga gccctagtta agaccgacga acaggaggtg atcaccttcc
      721 tgctgaccac cgagatcgtg cccttgtgcc tcagcatcat ggacagcggc tcggagctga
      781 gcaagaccgt ggccactttc attatccaga agatcttgct cgacgagtcc ggtttgtcgt
      841 acatctgcca gacctacgaa cgcttctcgc atgtggccat caccttgggc aaaatggtca
      901 tccagctgtc gaaggacccg tgtgctcgcc tcctgaagca tgtggtgcgt tgctatctgc
      961 gcctctcgga caacactcgc gctcgcaaag ccttgggcca gtgcctgccg gaccaactgc
     1021 gcgacgggac cttcgctctg tgcctgcagg acgacaagtc caccaagcag tggctgcaga
     1081 tgctgctcaa gaacctcgag ctgggcgtca caccgcagca gatcggcatg tcgccgctgg
     1141 gctcttagat agctaaagct gcaccacttc caagtattgc caaggcaatc caacaatcca
     1201 acatccaact ggttagctgc ccgaccgaat aatatattta ataagcttgc acaagattga
     1261 ttgcctgtgt ctaacctaag cagagctgta atataataac taaacataaa caaagtaccg
     1321 ataaagtaat gttaatacta agtttgtcac tgatactgat agcaaataaa gaacctcaag
     1381 cagacga