Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139622 1054 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017139622 VERSION XM_017139622.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139622.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1054 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1054 /gene="HP1b" /note="Heterochromatin Protein 1b; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:108056016" CDS 108..869 /gene="HP1b" /codon_start=1 /product="chromobox protein homolog 3" /protein_id="XP_016995111.2" /db_xref="GeneID:108056016" /translation="MAEFSVERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCP DLIANFEESLKNNKKETKKRLSTSSTPDSIRSKRKSFLEDDAEEQKKLIGFERGLEPS KILGATDSSGHLMFLMKWKGSDHADLVPAKLANIRCPQVVIQFYEERLTWHTGSGNGN GNGNGNTGNLASGSVGGSGAGDDTAPGSVGTIGGGSNAGEGGDEEQEEQEQEAEPASP AGSVSQDQQEPQDQDENAKPEESSELDNGQPDADD" misc_feature 114..263 /gene="HP1b" /note="chromodomain of heterochromatin protein 1 proteins, including HP1alpha, HP1beta, and HP1gamma; Region: CD_HP1_like; cd18631" /db_xref="CDD:349281" misc_feature order(114..125,174..176,180..185,189..191,201..203, 207..209,213..218,225..245) /gene="HP1b" /note="peptide binding site [polypeptide binding]; other site" /db_xref="CDD:349281" misc_feature 402..557 /gene="HP1b" /note="chromo shadow domain; Region: CSD; cd00034" /db_xref="CDD:349275" misc_feature order(414..416,420..434,456..458,483..485,543..545, 552..557) /gene="HP1b" /note="putative peptide binding site [polypeptide binding]; other site" /db_xref="CDD:349275" misc_feature order(426..428,540..548,552..557) /gene="HP1b" /note="putative binding pit [polypeptide binding]; other site" /db_xref="CDD:349275" misc_feature order(432..434,447..449,498..503,522..527,531..536, 543..548,552..557) /gene="HP1b" /note="homodimer interface [polypeptide binding]; other site" /db_xref="CDD:349275" polyA_site 1054 /gene="HP1b" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgcccatcgc caggccatct tcttcttcca ccgcgcaaaa tcacgtataa ataaaaattt 61 cgttgggacg ccgagaaaat caaaataata gcatccaaac ccaaacaatg gccgaattct 121 cagtggaacg cgtcgaggac aagcggacgg tgaacgggcg caccgagtac tacctgaagt 181 ggaagggcta tccgcgcagc gagaacacct gggagccggt ggagaatctc gactgccccg 241 atctgatagc caacttcgag gagtcgctga agaacaacaa gaaggagacc aagaagcgcc 301 tgtccacctc ctccacgccg gactccattc gcagcaagcg caagagcttc ctggaggacg 361 atgccgagga gcagaagaag ctgattggct tcgagcgcgg tttggagccc tcgaaaatcc 421 tgggcgccac cgactcgtcg ggccatctga tgttcctgat gaagtggaag ggcagcgacc 481 atgcggatct ggtgcccgcc aaactggcca acatccggtg tccccaggtc gtcatccagt 541 tctacgagga gcgcctcacc tggcacacgg gcagcggcaa tggtaatggc aatggcaacg 601 ggaacaccgg caatctggcc tcgggcagtg tgggtggcag tggcgccggc gacgacacgg 661 ctcccggcag cgtgggcacc atcggcggcg gcagcaatgc cggcgagggc ggcgacgagg 721 agcaggagga gcaggaacag gaggccgaac cggccagccc cgccggcagc gtcagccagg 781 accagcagga gccacaggac caggacgaga acgccaagcc cgaggagagc agcgagctgg 841 acaatggcca gccggatgcc gacgactagt tggattctag atggatacat acacgccgtc 901 ttaacaattt cgatctatac ataatatata catatttggt agcgtagccc gtaagcttaa 961 cgatcgatga ttaactgaag ttcttgtagt acatacttaa gctataagtt gaaatgtgac 1021 attttttttt aaatatcacc ctcttatttc gaat