PREDICTED: Drosophila takahashii (peptidyl-prolyl cis/trans

LOCUS       XM_017139500             717 bp    mRNA    linear   INV 09-DEC-2024
            isomerase) NIMA-interacting 1 dodo (dod), mRNA.
ACCESSION   XM_017139500
VERSION     XM_017139500.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139500.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..717
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..717
                     /gene="dod"
                     /note="(peptidyl-prolyl cis/trans isomerase)
                     NIMA-interacting 1 dodo; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108055919"
     CDS             103..621
                     /gene="dod"
                     /codon_start=1
                     /product="putative peptidyl-prolyl cis-trans isomerase
                     dodo"
                     /protein_id="XP_016994989.1"
                     /db_xref="GeneID:108055919"
                     /translation="MPDAEQLPEGWEKRTSRSTGLSYYLNVHTKESQWDQPTEPAKKT
                     GGGGGSNASAAAGGDAADEVQCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYR
                     NKIVNQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQASFEEAAFKLNVGQLSGIVD
                     SDSGLHIILRKS"
     misc_feature    121..219
                     /gene="dod"
                     /note="Domain with 2 conserved Trp (W) residues; Region:
                     WW; smart00456"
                     /db_xref="CDD:197736"
     misc_feature    order(169..171,202..204)
                     /gene="dod"
                     /note="binding pocket [active]"
                     /db_xref="CDD:238122"
     misc_feature    292..612
                     /gene="dod"
                     /note="peptidyl-prolyl cis-trans isomerase (PPIase);
                     Provisional; Region: PTZ00356"
                     /db_xref="CDD:185573"
     polyA_site      717
                     /gene="dod"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgttatcgct tttgtgttat cgacccatcg ctagtggttt attgccggag tgaaataaat
       61 taaatattgc aaattatatt ataaaacaga gccagatcca gcatgccaga cgccgaacaa
      121 ctgcccgagg gctgggagaa gcgcaccagc cgctccacag gactgagcta ctacctcaat
      181 gtgcacacca aggagtcgca gtgggatcag cccacggagc cggccaagaa gaccggcggc
      241 ggaggtggat ccaatgcctc ggccgccgct ggcggagatg ccgccgacga ggtgcagtgc
      301 ctccatctgc tggtgaagca caagggcagc cggcggccca gctcgtggcg cgaggcgaac
      361 atcacccgca ccaaggagga ggcccagctg ctcctcgagg tctatcgcaa caagatcgtc
      421 aaccaggagg ccaccttcga tgagctggcc cgctcctatt ccgactgcag ttccgccaag
      481 aggggcggcg acctcggaaa gttcggcaga ggtcaaatgc aggcatcgtt cgaggaggcc
      541 gccttcaaac tgaacgtcgg ccagctgtcg ggcatcgtcg acagcgattc cggcctgcac
      601 atcatactcc gcaaatccta gaaaaatcct cgactcctcc gccacgcagc tcacgtcact
      661 tcacatgaat aaaacggaat ttacagccat ttcaatatag aattatgtat tttaaaa