PREDICTED: Drosophila takahashii SRA stem-loop interacting RNA

LOCUS       XM_017139495             433 bp    mRNA    linear   INV 09-DEC-2024
            binding protein 1 (SLIRP1), mRNA.
ACCESSION   XM_017139495
VERSION     XM_017139495.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139495.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..433
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..433
                     /gene="SLIRP1"
                     /note="SRA stem-loop interacting RNA binding protein 1;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:108055916"
     CDS             161..433
                     /gene="SLIRP1"
                     /codon_start=1
                     /product="SRA stem-loop-interacting RNA-binding protein,
                     mitochondrial"
                     /protein_id="XP_016994984.1"
                     /db_xref="GeneID:108055916"
                     /translation="MATAAAVAKVGKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSA
                     NVIFDKRTGCSKGYGFVSFNSLAALEKIENEQKHILEGNYLNIQKS"
     misc_feature    206..424
                     /gene="SLIRP1"
                     /note="RNA recognition motif (RRM) found in SRA
                     stem-loop-interacting RNA-binding protein (SLIRP) and
                     similar proteins; Region: RRM_SLIRP; cd12242"
                     /db_xref="CDD:409688"
ORIGIN      
        1 aggcactgtt cagaaatacc ctctccctgt agggtattcc aaagtgctgt tagctgacag
       61 tttgaggtta tgtccgcccg cttcgcgtac aaaaacaaca gcaaccgtgg aatagaagcc
      121 gtcgtagttt ttacgcaacg caactggaaa cacctcatcc atggccaccg ccgcagctgt
      181 agcaaaagtg ggaaaatcag tgcaccgcat tttcgtgggc aatctgccgt ggacggtggg
      241 ccaccaggag ctgcgcggct actttcgcga attcggacgc gtggtgtccg ccaacgtgat
      301 cttcgacaag cgcaccggct gctccaaggg ctacggcttc gttagcttca acagcctggc
      361 ggcgctggag aagatcgaga acgagcagaa gcacatactg gagggcaact acctgaatat
      421 acagaaatcc tag