Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii acyl-CoA-binding domain-containing


LOCUS       XM_017139494             899 bp    mRNA    linear   INV 09-DEC-2024
            protein anorexia (anox), mRNA.
ACCESSION   XM_017139494
VERSION     XM_017139494.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139494.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..899
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..899
                     /gene="anox"
                     /note="acyl-CoA-binding domain-containing protein
                     anorexia; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108055915"
     CDS             1..732
                     /gene="anox"
                     /codon_start=1
                     /product="acyl-CoA-binding domain-containing protein 6"
                     /protein_id="XP_016994983.2"
                     /db_xref="GeneID:108055915"
                     /translation="MSDSDTDPEEELFHLAAEHVARQTSSLASADLLLLYGYYKQATE
                     GSCEEPSPGLLQLRARSKWQAWRSLGKMSQSKARQSYVRKLEELQPNWREKRKPGWVV
                     HSIESAPLEDQRADSEKTPFDHVKENNLERLRELLAPGDLAKLDEHGMALIHWATDRN
                     AVEIIRFLVHSGASVDQRDAEQQTPLHYAASCGHLEALRCLLELRANLELCDSDGQTC
                     YDVADDEQICQVLRTERERLSGSAS"
     misc_feature    28..255
                     /gene="anox"
                     /note="Acyl CoA binding protein; Region: ACBP; pfam00887"
                     /db_xref="CDD:459982"
     misc_feature    order(49..51,58..63,67..69,76..81,85..87,94..99,103..108,
                     115..120,169..174,181..186,241..243)
                     /gene="anox"
                     /note="acyl-CoA binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:240073"
     misc_feature    order(61..63,106..108,115..120,184..186,241..243)
                     /gene="anox"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:240073"
     misc_feature    <313..>693
                     /gene="anox"
                     /note="Ankyrin repeat [Signal transduction mechanisms];
                     Region: ANKYR; COG0666"
                     /db_xref="CDD:440430"
     misc_feature    order(376..384,388..393,403..405,412..414,436..438,
                     442..444,448..450,460..465,472..480,484..489,499..501,
                     508..510,535..537,541..543,547..549,559..564,571..579,
                     583..588,598..600,607..609,634..636)
                     /gene="anox"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    442..537
                     /gene="anox"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    541..636
                     /gene="anox"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     polyA_site      899
                     /gene="anox"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgtccgata gcgatacgga tcccgaggag gagctcttcc acctggccgc cgagcatgtg
       61 gccaggcaga cgagcagcct ggcctccgcc gacctgctgc tcctctacgg ctactacaaa
      121 caggccaccg agggctcgtg cgaggagccc agtcccgggc tgctccagct gcgggcacgc
      181 agcaagtggc aggcttggcg gagtctcggc aagatgtccc aatcgaaggc caggcagtcg
      241 tatgtccgca aactggagga gctgcagccg aattggcggg agaagcgcaa gcccggctgg
      301 gtggtgcact ccattgagtc ggcgccgctg gaggatcagc gggcggacag cgaaaagacc
      361 cccttcgatc atgtcaagga gaacaatctg gagcggttaa gggagctgct ggcgcccgga
      421 gatctcgcaa agttggatga acacggcatg gccctcatcc attgggccac cgatcgcaat
      481 gccgtcgaga tcattcggtt tctggtccac agcggagcga gtgtcgatca gcgggatgcc
      541 gagcagcaga cgccgctgca ctatgccgcc agttgtggtc acctggaggc tctgcgctgc
      601 ctgctcgagc tgcgcgccaa tctggagctc tgcgattccg atggacagac ctgctacgac
      661 gtggccgacg atgaacagat ctgccaggtg ctccgaacgg agcgagagcg cctcagtgga
      721 tccgcctcct aaatcttaag ttgttaggtg cgaagaaccc tgtaaaatgt tgtgaataaa
      781 tcctctgtaa gcttggtttt ctcacatcca tatacacaaa cggtacgctt cttaaccttt
      841 taagttgtca agttgcttat gcataatatg taatgtatta aaaagtacta aaactgtga