Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139494 899 bp mRNA linear INV 09-DEC-2024 protein anorexia (anox), mRNA. ACCESSION XM_017139494 VERSION XM_017139494.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139494.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..899 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..899 /gene="anox" /note="acyl-CoA-binding domain-containing protein anorexia; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108055915" CDS 1..732 /gene="anox" /codon_start=1 /product="acyl-CoA-binding domain-containing protein 6" /protein_id="XP_016994983.2" /db_xref="GeneID:108055915" /translation="MSDSDTDPEEELFHLAAEHVARQTSSLASADLLLLYGYYKQATE GSCEEPSPGLLQLRARSKWQAWRSLGKMSQSKARQSYVRKLEELQPNWREKRKPGWVV HSIESAPLEDQRADSEKTPFDHVKENNLERLRELLAPGDLAKLDEHGMALIHWATDRN AVEIIRFLVHSGASVDQRDAEQQTPLHYAASCGHLEALRCLLELRANLELCDSDGQTC YDVADDEQICQVLRTERERLSGSAS" misc_feature 28..255 /gene="anox" /note="Acyl CoA binding protein; Region: ACBP; pfam00887" /db_xref="CDD:459982" misc_feature order(49..51,58..63,67..69,76..81,85..87,94..99,103..108, 115..120,169..174,181..186,241..243) /gene="anox" /note="acyl-CoA binding pocket [chemical binding]; other site" /db_xref="CDD:240073" misc_feature order(61..63,106..108,115..120,184..186,241..243) /gene="anox" /note="CoA binding site [chemical binding]; other site" /db_xref="CDD:240073" misc_feature <313..>693 /gene="anox" /note="Ankyrin repeat [Signal transduction mechanisms]; Region: ANKYR; COG0666" /db_xref="CDD:440430" misc_feature order(376..384,388..393,403..405,412..414,436..438, 442..444,448..450,460..465,472..480,484..489,499..501, 508..510,535..537,541..543,547..549,559..564,571..579, 583..588,598..600,607..609,634..636) /gene="anox" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:293786" misc_feature 442..537 /gene="anox" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature 541..636 /gene="anox" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" polyA_site 899 /gene="anox" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgtccgata gcgatacgga tcccgaggag gagctcttcc acctggccgc cgagcatgtg 61 gccaggcaga cgagcagcct ggcctccgcc gacctgctgc tcctctacgg ctactacaaa 121 caggccaccg agggctcgtg cgaggagccc agtcccgggc tgctccagct gcgggcacgc 181 agcaagtggc aggcttggcg gagtctcggc aagatgtccc aatcgaaggc caggcagtcg 241 tatgtccgca aactggagga gctgcagccg aattggcggg agaagcgcaa gcccggctgg 301 gtggtgcact ccattgagtc ggcgccgctg gaggatcagc gggcggacag cgaaaagacc 361 cccttcgatc atgtcaagga gaacaatctg gagcggttaa gggagctgct ggcgcccgga 421 gatctcgcaa agttggatga acacggcatg gccctcatcc attgggccac cgatcgcaat 481 gccgtcgaga tcattcggtt tctggtccac agcggagcga gtgtcgatca gcgggatgcc 541 gagcagcaga cgccgctgca ctatgccgcc agttgtggtc acctggaggc tctgcgctgc 601 ctgctcgagc tgcgcgccaa tctggagctc tgcgattccg atggacagac ctgctacgac 661 gtggccgacg atgaacagat ctgccaggtg ctccgaacgg agcgagagcg cctcagtgga 721 tccgcctcct aaatcttaag ttgttaggtg cgaagaaccc tgtaaaatgt tgtgaataaa 781 tcctctgtaa gcttggtttt ctcacatcca tatacacaaa cggtacgctt cttaaccttt 841 taagttgtca agttgcttat gcataatatg taatgtatta aaaagtacta aaactgtga