PREDICTED: Drosophila takahashii serine protease SP24D

LOCUS       XM_017139467             874 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108055904), mRNA.
ACCESSION   XM_017139467
VERSION     XM_017139467.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139467.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..874
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..874
                     /gene="LOC108055904"
                     /note="serine protease SP24D; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:108055904"
     CDS             1..780
                     /gene="LOC108055904"
                     /codon_start=1
                     /product="serine protease SP24D"
                     /protein_id="XP_016994956.3"
                     /db_xref="GeneID:108055904"
                     /translation="MLSYWTFLPLFCGALVVLGQVQTKNRNETEIEPRIVGGTKAKEG
                     QFPHQISLRLRDEHYCGGVIISNNYVITAAHCVKHGNDVPPADLWSIQAGSLLLSSGG
                     VRIPVAEVIVHPEYKTDGSFDLALLRLQNSLTFDSNIAAIPLATEDPAVGCSVDISGW
                     GKVSEKGALSDSLLYVKTTHLSRERCRWWYRRLPETMICLVHPSNKGACFGDSGGPAT
                     YNGKVVGLASLLLTGGCGRAGPDGYQKISTLRSWIVEKAGL"
     misc_feature    103..759
                     /gene="LOC108055904"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    103..105
                     /gene="LOC108055904"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(223..225,367..369,637..639)
                     /gene="LOC108055904"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(619..621,682..684,697..699)
                     /gene="LOC108055904"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     polyA_site      874
                     /gene="LOC108055904"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgctaagtt actggacttt tttgccactg ttttgtggtg cactagtagt cctgggacag
       61 gttcagacca agaatagaaa tgaaaccgaa atagaacccc ggattgtggg cggaaccaag
      121 gcgaaggagg gacaatttcc ccatcagatt tccctgcgtc ttcgcgatga acattattgc
      181 ggtggcgtca taatttccaa caactacgtc atcaccgcgg ctcattgtgt taagcatgga
      241 aatgatgtac ctcctgctga tctgtggtcg attcaggcgg gaagtctgct cctctcgagt
      301 ggcggagtta ggatccctgt ggccgaagtt atcgtacatc ccgagtacaa gaccgacggc
      361 tctttcgatc tggccttgct tcgactgcag aactcgctga cattcgattc caacatcgct
      421 gccatcccac tggccaccga ggatccggct gtcggttgct ccgtggacat ttccggttgg
      481 ggaaaagtat ccgaaaaggg agccctctcc gacagcctgt tgtacgtgaa gacgacccat
      541 ttgtcgcggg agagatgtcg ctggtggtat cgccgtttgc ccgagaccat gatctgcctc
      601 gtgcatccca gcaacaaggg cgcctgtttc ggggactccg gcggaccggc cacctacaac
      661 ggcaaagtgg tgggcctggc cagtctcctg ctcaccggtg gctgtggacg agccggtccg
      721 gatggctacc aaaagatatc cacactgagg tcctggatcg tggagaaggc gggcttgtaa
      781 tgattcagtg gcactggtcc agcacacaag tgcattttaa atattaaaaa ataatgaaca
      841 ttttaaaaat ataaaagtta accccgttat ttaa