Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139452 1161 bp mRNA linear INV 09-DEC-2024 transcript variant X1, mRNA. ACCESSION XM_017139452 VERSION XM_017139452.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139452.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1161 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1161 /gene="ccb" /note="central complex broad; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108055895" CDS 111..959 /gene="ccb" /codon_start=1 /product="uncharacterized protein ccb" /protein_id="XP_016994941.3" /db_xref="GeneID:108055895" /translation="MSIPENPEMNIEGEATLRAQRYTWDEFCGVVGGFAVPRFVWQLI LCRDLRLSGLWLFLGLVVIDFLTSHSLPQLLGMAGLMLLVHLLIYSAIRPYVRFLPYE ELLDCRINVSKSLDLGVRVVGQVANCINRSVATAQFLLLGTDLQASLLLLFVLMEVRA ILCWINLSTLIKIAYCLAIVVPKLWEAFLLWMDSRGLNNPYLIALLKEVFSREFIFEC LEQLAMEVQLYSAKYFELEAEKTEPEGANSGEIQVADVDTTGDEMSMESGEEIQVAVV DRTGQD" misc_feature <465..668 /gene="ccb" /note="Region: Reticulon; pfam02453" /db_xref="CDD:460562" ORIGIN 1 gttgacaatt cccttcagtt ataaccagaa ctccgtcgac tcaacaacga aatcgaaaaa 61 ttatttattt tcctagtgca tttttacttc aagaacttca ttgaacaatc atgagtattc 121 ccgagaatcc agagatgaat atagaggggg aggcaacttt gcgagcacag agatatacat 181 gggatgagtt ttgcggggtg gtgggcggct ttgccgtgcc ccgcttcgtg tggcaattga 241 tcctgtgccg cgatctcaga ctcagtggcc tctggttgtt cctcggactc gtggtcatcg 301 acttcctgac cagtcactcg ctgccccagc tgctgggcat ggcgggcctg atgctcctgg 361 tccatctgct gatctactcg gccatccggc catacgtgcg ctttctgccc tacgaggagc 421 tgctggattg ccggatcaat gtatcgaagt cgctggacct gggcgtccgt gtggtcggcc 481 aggtggccaa ctgcatcaac cgctcggtgg ccaccgctca gttcctcctc ctcggaacgg 541 acctgcaggc cagcctcctg ctgctgttcg tcctgatgga ggtgcgcgcc atcctctgct 601 ggataaacct ctccacgctg attaagatcg cctactgtct ggcgattgtt gttccaaaat 661 tgtgggaggc tttccttctt tggatggact cacggggttt aaataatcct tacctgatcg 721 cactcctgaa ggaagttttc agcagggaat ttatttttga gtgcctggag cagctggcca 781 tggaggtgca actgtacagt gccaagtatt ttgaactgga agcggagaaa acggaacccg 841 agggagctaa tagtggggaa atccaggtgg cagatgtcga taccactggc gatgagatgt 901 cgatggaaag tggcgaggaa attcaagtgg cagtggtcga taggactggc caagactaag 961 aatcggcaga ctatcaaacg tatttggttt tctttatttc tggttaaata tgttcaacgt 1021 ttccattcaa tccaaataca catactcaaa agacacacac tacacatcga agccaattga 1081 aaccactgaa gttatagtta ctaacaactt acgccataaa acacgataaa atataaatac 1141 actcattaca cacaagaaat t