Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii central complex broad (ccb),


LOCUS       XM_017139452            1161 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X1, mRNA.
ACCESSION   XM_017139452
VERSION     XM_017139452.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139452.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1161
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1161
                     /gene="ccb"
                     /note="central complex broad; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108055895"
     CDS             111..959
                     /gene="ccb"
                     /codon_start=1
                     /product="uncharacterized protein ccb"
                     /protein_id="XP_016994941.3"
                     /db_xref="GeneID:108055895"
                     /translation="MSIPENPEMNIEGEATLRAQRYTWDEFCGVVGGFAVPRFVWQLI
                     LCRDLRLSGLWLFLGLVVIDFLTSHSLPQLLGMAGLMLLVHLLIYSAIRPYVRFLPYE
                     ELLDCRINVSKSLDLGVRVVGQVANCINRSVATAQFLLLGTDLQASLLLLFVLMEVRA
                     ILCWINLSTLIKIAYCLAIVVPKLWEAFLLWMDSRGLNNPYLIALLKEVFSREFIFEC
                     LEQLAMEVQLYSAKYFELEAEKTEPEGANSGEIQVADVDTTGDEMSMESGEEIQVAVV
                     DRTGQD"
     misc_feature    <465..668
                     /gene="ccb"
                     /note="Region: Reticulon; pfam02453"
                     /db_xref="CDD:460562"
ORIGIN      
        1 gttgacaatt cccttcagtt ataaccagaa ctccgtcgac tcaacaacga aatcgaaaaa
       61 ttatttattt tcctagtgca tttttacttc aagaacttca ttgaacaatc atgagtattc
      121 ccgagaatcc agagatgaat atagaggggg aggcaacttt gcgagcacag agatatacat
      181 gggatgagtt ttgcggggtg gtgggcggct ttgccgtgcc ccgcttcgtg tggcaattga
      241 tcctgtgccg cgatctcaga ctcagtggcc tctggttgtt cctcggactc gtggtcatcg
      301 acttcctgac cagtcactcg ctgccccagc tgctgggcat ggcgggcctg atgctcctgg
      361 tccatctgct gatctactcg gccatccggc catacgtgcg ctttctgccc tacgaggagc
      421 tgctggattg ccggatcaat gtatcgaagt cgctggacct gggcgtccgt gtggtcggcc
      481 aggtggccaa ctgcatcaac cgctcggtgg ccaccgctca gttcctcctc ctcggaacgg
      541 acctgcaggc cagcctcctg ctgctgttcg tcctgatgga ggtgcgcgcc atcctctgct
      601 ggataaacct ctccacgctg attaagatcg cctactgtct ggcgattgtt gttccaaaat
      661 tgtgggaggc tttccttctt tggatggact cacggggttt aaataatcct tacctgatcg
      721 cactcctgaa ggaagttttc agcagggaat ttatttttga gtgcctggag cagctggcca
      781 tggaggtgca actgtacagt gccaagtatt ttgaactgga agcggagaaa acggaacccg
      841 agggagctaa tagtggggaa atccaggtgg cagatgtcga taccactggc gatgagatgt
      901 cgatggaaag tggcgaggaa attcaagtgg cagtggtcga taggactggc caagactaag
      961 aatcggcaga ctatcaaacg tatttggttt tctttatttc tggttaaata tgttcaacgt
     1021 ttccattcaa tccaaataca catactcaaa agacacacac tacacatcga agccaattga
     1081 aaccactgaa gttatagtta ctaacaactt acgccataaa acacgataaa atataaatac
     1141 actcattaca cacaagaaat t