Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139451 924 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017139451 VERSION XM_017139451.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139451.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..924 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..924 /gene="LOC108055894" /note="loricrin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108055894" CDS 120..692 /gene="LOC108055894" /codon_start=1 /product="loricrin" /protein_id="XP_016994940.2" /db_xref="GeneID:108055894" /translation="MKVFVCLIACFSLAQSGYIGGGGGGWSSGGGGGGWSSGGGAAPP TIVKVISEEAGHGGWSSGGSGGGWSSGGGWSSGGGHGAAEELKIIKVISESGHSHHDH SHDHGHGHGHSHGSEVKIIKVIQEEDHGHGHGHGYDYSSGGYGGHHTEDVKIIKLISS GIADGGWSSGGSGGGWSSGAPSGGWSSGWN" ORIGIN 1 cgatcgtata tatagtagcc tcggggcaaa gcattgtcat cagtttacga gctcagctcc 61 ccaatcccac ttcgtccatc gccaagtgcc agttcaaccc aagcggaacc gacaacaaga 121 tgaaggtttt cgtctgcctg attgcctgct ttagcctggc ccaatccgga tatatcggag 181 gtggtggcgg tggctggtct tccggcggag gcggtggtgg ttggtcctcc ggcggtggtg 241 ctgcaccccc caccattgtc aaggtcatca gcgaggaggc tggccatggc ggctggtcct 301 ccggtggatc tggaggtggt tggtcatctg gaggtggttg gtcctccggt ggtggccatg 361 gagctgccga ggagctcaag atcatcaagg tgatcagtga atcgggtcac tcgcatcatg 421 atcactccca tgatcacggg cacggtcacg gtcacagcca cggctcggag gtgaagatca 481 ttaaggtcat ccaggaggag gaccatggtc atggtcatgg tcatggctac gactactcca 541 gcggcggcta tggaggtcac cacaccgagg atgtcaagat catcaagctg atcagctccg 601 gaatcgccga tggcggttgg tcctccggcg gttcgggagg cggttggtcc tctggagctc 661 ccagcggtgg ctggtcttcc ggctggaact aaggagatcc gaggaaatcc caggcagatc 721 caagtcccca ggcaatccag tgcgttgatg ccaactcttt tgttcctgtt gttcgagttg 781 cacggcgata ttggctcttt ttttctgatg ttacgaagtt atgtttaaga tagtgcacgc 841 tttttgtgtg tgcgcttaga aactattagt tttttttttg tatttttgtt aactgtttac 901 aaaatatata tgaacgaaaa aaaa