Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii loricrin (LOC108055894), mRNA.


LOCUS       XM_017139451             924 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139451
VERSION     XM_017139451.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139451.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..924
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..924
                     /gene="LOC108055894"
                     /note="loricrin; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108055894"
     CDS             120..692
                     /gene="LOC108055894"
                     /codon_start=1
                     /product="loricrin"
                     /protein_id="XP_016994940.2"
                     /db_xref="GeneID:108055894"
                     /translation="MKVFVCLIACFSLAQSGYIGGGGGGWSSGGGGGGWSSGGGAAPP
                     TIVKVISEEAGHGGWSSGGSGGGWSSGGGWSSGGGHGAAEELKIIKVISESGHSHHDH
                     SHDHGHGHGHSHGSEVKIIKVIQEEDHGHGHGHGYDYSSGGYGGHHTEDVKIIKLISS
                     GIADGGWSSGGSGGGWSSGAPSGGWSSGWN"
ORIGIN      
        1 cgatcgtata tatagtagcc tcggggcaaa gcattgtcat cagtttacga gctcagctcc
       61 ccaatcccac ttcgtccatc gccaagtgcc agttcaaccc aagcggaacc gacaacaaga
      121 tgaaggtttt cgtctgcctg attgcctgct ttagcctggc ccaatccgga tatatcggag
      181 gtggtggcgg tggctggtct tccggcggag gcggtggtgg ttggtcctcc ggcggtggtg
      241 ctgcaccccc caccattgtc aaggtcatca gcgaggaggc tggccatggc ggctggtcct
      301 ccggtggatc tggaggtggt tggtcatctg gaggtggttg gtcctccggt ggtggccatg
      361 gagctgccga ggagctcaag atcatcaagg tgatcagtga atcgggtcac tcgcatcatg
      421 atcactccca tgatcacggg cacggtcacg gtcacagcca cggctcggag gtgaagatca
      481 ttaaggtcat ccaggaggag gaccatggtc atggtcatgg tcatggctac gactactcca
      541 gcggcggcta tggaggtcac cacaccgagg atgtcaagat catcaagctg atcagctccg
      601 gaatcgccga tggcggttgg tcctccggcg gttcgggagg cggttggtcc tctggagctc
      661 ccagcggtgg ctggtcttcc ggctggaact aaggagatcc gaggaaatcc caggcagatc
      721 caagtcccca ggcaatccag tgcgttgatg ccaactcttt tgttcctgtt gttcgagttg
      781 cacggcgata ttggctcttt ttttctgatg ttacgaagtt atgtttaaga tagtgcacgc
      841 tttttgtgtg tgcgcttaga aactattagt tttttttttg tatttttgtt aactgtttac
      901 aaaatatata tgaacgaaaa aaaa