Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii myotrophin (LOC108055885), mRNA.


LOCUS       XM_017139439             606 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139439
VERSION     XM_017139439.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139439.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..606
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..606
                     /gene="LOC108055885"
                     /note="myotrophin; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108055885"
     CDS             101..472
                     /gene="LOC108055885"
                     /codon_start=1
                     /product="myotrophin"
                     /protein_id="XP_016994928.1"
                     /db_xref="GeneID:108055885"
                     /translation="MGSIEDIIWTIKHGEYDEVERFFLAGCHNVNDQMGVRFPLHYAA
                     DFGQLKLLKFFVRIGAEVDRKDKYGITPLLAAIWEGHTRCVEFLLQMGASRTERTPQG
                     QSYAEAAEQDDIRRLLAQDSS"
     misc_feature    <119..460
                     /gene="LOC108055885"
                     /note="Ankyrin repeat [Signal transduction mechanisms];
                     Region: ANKYR; COG0666"
                     /db_xref="CDD:440430"
     misc_feature    order(122..127,134..142,146..151,161..163,170..172,
                     194..196,200..202,206..208,221..226,233..241,245..250,
                     260..262,269..271,296..298,302..304,308..310,320..325,
                     332..340,344..349,359..361,368..370)
                     /gene="LOC108055885"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    200..298
                     /gene="LOC108055885"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    302..394
                     /gene="LOC108055885"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
ORIGIN      
        1 ctaagcaaca aagcagcaag ctttccaaac tatccagact taatttaaat cgcacgattt
       61 gactgtactg tcgcactgag aaagcgagag ttagttaacg atgggcagca tcgaggacat
      121 catctggacg attaagcacg gcgagtacga tgaggtggag cgctttttcc tggccggctg
      181 ccacaatgtc aacgatcaga tgggcgtccg ctttcccctg cactatgccg ccgactttgg
      241 ccagctgaag ctgctcaagt tcttcgtgcg gattggggcg gaggtggatc gcaaggacaa
      301 gtacgggatc acaccgctct tggcggccat ctgggagggt cacacgcgct gcgtcgagtt
      361 cctgctgcag atgggcgcca gtcgcacgga gaggacgccc caaggtcaga gctacgcgga
      421 ggcagccgag caggacgaca tccgacgtct tttggcccag gattccagtt agagttccct
      481 tggcattcca cttgcatact gctatctaca ttttgtaaat tcatagtgca cgattaatag
      541 attctttgtt tagttggccg gtaattaaaa cagtagttta actaacagct taacaatctt
      601 caaaaa