Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139439 606 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017139439 VERSION XM_017139439.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139439.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..606 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..606 /gene="LOC108055885" /note="myotrophin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108055885" CDS 101..472 /gene="LOC108055885" /codon_start=1 /product="myotrophin" /protein_id="XP_016994928.1" /db_xref="GeneID:108055885" /translation="MGSIEDIIWTIKHGEYDEVERFFLAGCHNVNDQMGVRFPLHYAA DFGQLKLLKFFVRIGAEVDRKDKYGITPLLAAIWEGHTRCVEFLLQMGASRTERTPQG QSYAEAAEQDDIRRLLAQDSS" misc_feature <119..460 /gene="LOC108055885" /note="Ankyrin repeat [Signal transduction mechanisms]; Region: ANKYR; COG0666" /db_xref="CDD:440430" misc_feature order(122..127,134..142,146..151,161..163,170..172, 194..196,200..202,206..208,221..226,233..241,245..250, 260..262,269..271,296..298,302..304,308..310,320..325, 332..340,344..349,359..361,368..370) /gene="LOC108055885" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:293786" misc_feature 200..298 /gene="LOC108055885" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" misc_feature 302..394 /gene="LOC108055885" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" ORIGIN 1 ctaagcaaca aagcagcaag ctttccaaac tatccagact taatttaaat cgcacgattt 61 gactgtactg tcgcactgag aaagcgagag ttagttaacg atgggcagca tcgaggacat 121 catctggacg attaagcacg gcgagtacga tgaggtggag cgctttttcc tggccggctg 181 ccacaatgtc aacgatcaga tgggcgtccg ctttcccctg cactatgccg ccgactttgg 241 ccagctgaag ctgctcaagt tcttcgtgcg gattggggcg gaggtggatc gcaaggacaa 301 gtacgggatc acaccgctct tggcggccat ctgggagggt cacacgcgct gcgtcgagtt 361 cctgctgcag atgggcgcca gtcgcacgga gaggacgccc caaggtcaga gctacgcgga 421 ggcagccgag caggacgaca tccgacgtct tttggcccag gattccagtt agagttccct 481 tggcattcca cttgcatact gctatctaca ttttgtaaat tcatagtgca cgattaatag 541 attctttgtt tagttggccg gtaattaaaa cagtagttta actaacagct taacaatctt 601 caaaaa