Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ctenidin-1 (LOC108055884), mRNA.


LOCUS       XM_017139437             826 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139437
VERSION     XM_017139437.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139437.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..826
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..826
                     /gene="LOC108055884"
                     /note="ctenidin-1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108055884"
     CDS             100..684
                     /gene="LOC108055884"
                     /codon_start=1
                     /product="ctenidin-1"
                     /protein_id="XP_016994926.2"
                     /db_xref="GeneID:108055884"
                     /translation="MKVFVCLLAVCSMAHAGFLGGGGSAVSSGWSSGGGGGYGGGYSG
                     GHGGGGYSGGGGYGGGGYGGGGYSGGHGGGGGTVKIIKVITDSGAGGGYGGGGYSGGH
                     GGGYGGGSSGGYSGGHGGGWSSGGYSGGGGYGGGGGYGSGGNIKIIKVISDSGSSGGY
                     GGGYGGGSAGGYSSGGYSSGGGWAPQGGWAQSSW"
ORIGIN      
        1 gcggccaaaa cactgcagac cacagtcgaa gatcgccctt ccatctcgac acagtcgcag
       61 ttcttctcca ggcaatcaat ctctaaaaaa cacctcgaca tgaaggtttt cgtctgcttg
      121 ctggcggtgt gcagtatggc ccatgcggga ttcctgggcg gcggcggaag tgccgttagc
      181 tccggctggt cctcgggcgg cggaggagga tatggcggtg gctacagcgg tggccacgga
      241 ggaggtggct acagcggagg cggtggctat ggaggcggtg gctatggagg cggtggctac
      301 agtggaggcc atggaggagg cggtggcacc gttaagatca tcaaggtgat caccgattct
      361 ggagctggcg gcggctacgg aggcggtggc tacagcggag gccatggcgg tggctacgga
      421 ggtggctcat ccggtggcta cagcggaggt cacggcggtg gctggtcctc aggtggctac
      481 agcggtggtg gtggatatgg cggcggcggt ggctacggaa gcggtggcaa catcaagatc
      541 atcaaggtca tctccgattc cggctcgagc ggcggctacg gtggtggcta tggaggtggt
      601 tccgccggtg gctactcctc cggcggctac tcctccggcg gcggttgggc tcctcagggc
      661 ggctgggccc agagcagttg gtaaacgctc ttcgttggtc aacggatgct attttgttac
      721 tgtttctaac cgaccttaat tgtaaatact tcccaacatt aatgaataaa taaacagagt
      781 tgagccattc caccaaaaaa aaaaataatt gtcaattaac ccagca