Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139437 826 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017139437 VERSION XM_017139437.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139437.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..826 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..826 /gene="LOC108055884" /note="ctenidin-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108055884" CDS 100..684 /gene="LOC108055884" /codon_start=1 /product="ctenidin-1" /protein_id="XP_016994926.2" /db_xref="GeneID:108055884" /translation="MKVFVCLLAVCSMAHAGFLGGGGSAVSSGWSSGGGGGYGGGYSG GHGGGGYSGGGGYGGGGYGGGGYSGGHGGGGGTVKIIKVITDSGAGGGYGGGGYSGGH GGGYGGGSSGGYSGGHGGGWSSGGYSGGGGYGGGGGYGSGGNIKIIKVISDSGSSGGY GGGYGGGSAGGYSSGGYSSGGGWAPQGGWAQSSW" ORIGIN 1 gcggccaaaa cactgcagac cacagtcgaa gatcgccctt ccatctcgac acagtcgcag 61 ttcttctcca ggcaatcaat ctctaaaaaa cacctcgaca tgaaggtttt cgtctgcttg 121 ctggcggtgt gcagtatggc ccatgcggga ttcctgggcg gcggcggaag tgccgttagc 181 tccggctggt cctcgggcgg cggaggagga tatggcggtg gctacagcgg tggccacgga 241 ggaggtggct acagcggagg cggtggctat ggaggcggtg gctatggagg cggtggctac 301 agtggaggcc atggaggagg cggtggcacc gttaagatca tcaaggtgat caccgattct 361 ggagctggcg gcggctacgg aggcggtggc tacagcggag gccatggcgg tggctacgga 421 ggtggctcat ccggtggcta cagcggaggt cacggcggtg gctggtcctc aggtggctac 481 agcggtggtg gtggatatgg cggcggcggt ggctacggaa gcggtggcaa catcaagatc 541 atcaaggtca tctccgattc cggctcgagc ggcggctacg gtggtggcta tggaggtggt 601 tccgccggtg gctactcctc cggcggctac tcctccggcg gcggttgggc tcctcagggc 661 ggctgggccc agagcagttg gtaaacgctc ttcgttggtc aacggatgct attttgttac 721 tgtttctaac cgaccttaat tgtaaatact tcccaacatt aatgaataaa taaacagagt 781 tgagccattc caccaaaaaa aaaaataatt gtcaattaac ccagca