Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii SKP1-related A (SkpA), mRNA.


LOCUS       XM_017139364             969 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139364
VERSION     XM_017139364.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139364.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..969
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..969
                     /gene="SkpA"
                     /note="SKP1-related A; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 17 Proteins"
                     /db_xref="GeneID:108055828"
     CDS             164..652
                     /gene="SkpA"
                     /codon_start=1
                     /product="S-phase kinase-associated protein 1"
                     /protein_id="XP_016994853.1"
                     /db_xref="GeneID:108055828"
                     /translation="MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIV
                     PLPNVNSTILRKVLTWAHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFEL
                     ILAANYLDIKGLLELTCKTVANMIKGKTPEEIRKTFNIKKDFTPAEEEQVRKENEWCE
                     EK"
     misc_feature    173..541
                     /gene="SkpA"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ
                     (poxvirus and zinc finger) domain found in S-phase
                     kinase-associated protein 1 (SKP1) and similar proteins;
                     Region: BTB_POZ_SKP1; cd18322"
                     /db_xref="CDD:349631"
     misc_feature    order(236..241,251..253,263..265,275..283,296..298,
                     302..307,473..475,482..487,491..493)
                     /gene="SkpA"
                     /note="cullin binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:349631"
     misc_feature    order(449..451,461..463,473..475,482..484,497..499,
                     509..511,518..523,527..532,539..541)
                     /gene="SkpA"
                     /note="F-box protein binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:349631"
     misc_feature    497..640
                     /gene="SkpA"
                     /note="Skp1 family, dimerization domain; Region: Skp1;
                     pfam01466"
                     /db_xref="CDD:460222"
     polyA_site      969
                     /gene="SkpA"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctccaatcgt tgttccacct ctaagtgctc tgcatatttt ttttcttccc gaaacgaatc
       61 ttcgattgtg gcttattttt catcccaaaa ggagctcccg tgcaagtagt tgcagtaatt
      121 cgaagacaat accttaagaa aaagcgataa aaaaataagc aatatgccca gcatcaagtt
      181 gcaatcttcg gacgaggaga tcttcgacac ggacatccag atcgccaagt gctcggggac
      241 catcaagacc atgctggagg attgcggcat ggaggacgac gagaatgcca ttgtgccgct
      301 gcccaatgtg aactcgacga tcctccgcaa agtgctcacc tgggcccact accacaagga
      361 cgatccccag ccgacggagg acgatgagag caaggagaag cgcaccgacg acatcatctc
      421 ctgggatgcc gacttcctca aggtcgatca gggcaccctg ttcgagctca tcctggcggc
      481 caactatctg gacatcaagg gactgctcga gctcacctgc aagacggtgg ccaacatgat
      541 caagggcaag actcccgagg agatccgcaa gaccttcaac atcaagaagg actttacgcc
      601 cgccgaggag gagcaggtgc gcaaggagaa cgagtggtgc gaggagaagt agaccgctct
      661 cgaccaggat caagttataa agcaggagga ggaggaagac agcagacgga tgcagatgcg
      721 aagcagacat ggagtcatgc cgatgccgca ttggagcttt atttagttgc tactctcatt
      781 tcacattttt ttttgttctc taccctgaaa gaccctcatt ttgaatttga ataactgaac
      841 gggcttgatg tgattcacgg ggttattcgt tctatgcgaa aatgcataac tctatgtagc
      901 ctacatatat gaataagaac actatgattt caccttaata aatatgtact acccaaacac
      961 acaaaacaa