PREDICTED: Drosophila takahashii technical knockout (tko), mRNA.

LOCUS       XM_017139363             677 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139363
VERSION     XM_017139363.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139363.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..677
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..677
                     /gene="tko"
                     /note="technical knockout; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108055827"
     CDS             177..599
                     /gene="tko"
                     /codon_start=1
                     /product="small ribosomal subunit protein uS12m"
                     /protein_id="XP_016994852.1"
                     /db_xref="GeneID:108055827"
                     /translation="MNFLRQTLGITKQLTSQAIQSSLETAMRGMASLQQMHRSGPHVK
                     TRPPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNL
                     QEHNIVLCRVGRLQDVPGVKLKAVRGVYDLAHVVKKSQ"
     misc_feature    270..590
                     /gene="tko"
                     /note="S12-like family, 30S ribosomal protein S12
                     subfamily; S12 is located at the interface of the large
                     and small ribosomal subunits of prokaryotes, chloroplasts
                     and mitochondria, where it plays an important role in both
                     tRNA and ribosomal subunit...; Region: Ribosomal_S12;
                     cd03368"
                     /db_xref="CDD:239466"
     misc_feature    order(273..278,282..287,294..299)
                     /gene="tko"
                     /note="S17 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239466"
     misc_feature    273..275
                     /gene="tko"
                     /note="S8 interaction site [active]"
                     /db_xref="CDD:239466"
     misc_feature    order(297..305,336..338,342..347,351..353,396..401,
                     405..413,432..434,456..458,465..470,507..512,522..527,
                     588..590)
                     /gene="tko"
                     /note="16S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(387..392,522..524)
                     /gene="tko"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    390..395
                     /gene="tko"
                     /note="23S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(393..410,468..494)
                     /gene="tko"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239466"
     polyA_site      677
                     /gene="tko"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttagccctca cggtcacact gtaagtgcga attggaatgg aattggatta ttattatttt
       61 taaccaatta atgactaaaa ctgcctaaag taaccaacta aacagctgct agacaagctc
      121 cacggcgtcg ggggaaaggc ttccagcacc tacaacctga accaaacagc acaaacatga
      181 atttcctgcg gcaaacgttg ggcattacga aacagttgac ttcgcaggcc atccagagca
      241 gtttggagac cgccatgcgt gggatggcct cgctgcagca gatgcaccgc agcgggccgc
      301 acgtgaagac gcgacccccg cgccagcccc tcgacgggaa gcccttcgcc aagggcgtcg
      361 tgctcaagac gctgatcaag aagcccaaga agccgaactc ggccaaccgc aagtgcgtgc
      421 tggtgcggct ctccaccggc aaggagatgg tggcctacat ccccggcatc gggcacaacc
      481 tgcaggagca caacatcgtc ctgtgccgcg tcggccgtct gcaggatgtg cccggcgtga
      541 agctgaaggc tgtgcgcgga gtctacgacc tggcgcacgt cgtcaagaag agccaatagt
      601 tatagatgta gatatatccc ccttatcatc caaacacaca ctgttcaaat gcaagactct
      661 acaatcaaga aaccgca