Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139361 1328 bp mRNA linear INV 09-DEC-2024 carrier (LOC108055825), mRNA. ACCESSION XM_017139361 VERSION XM_017139361.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139361.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1328 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1328 /gene="LOC108055825" /note="mitochondrial 2-oxodicarboxylate carrier; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108055825" CDS 244..1164 /gene="LOC108055825" /codon_start=1 /product="mitochondrial 2-oxodicarboxylate carrier" /protein_id="XP_016994850.1" /db_xref="GeneID:108055825" /translation="MAVQPQEISHAKRAAFQVLAGGSAGFLEVCIMQPLDVVKTRIQI QATPAPNAAALGELHYNGVFDCFAKMYRHEGISSYWKGIMPPILAETPKRAIKFLVFE QTKPLFQFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQADRQKKMLSTFAVA KGIIKQDGLGFRGLNKGITATMGRNGVFNMVYFGFYHSVKNVVPEYKENHLEFLRKVT IGFLAGTLACFVNIPFDVAKSRIQGPQPVAGQIKYRGTLSSMGIVYREEGFRALYKGL VPKIMRLGPGGAILLLVFEYSYDYLLHNYS" misc_feature 295..579 /gene="LOC108055825" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature 607..864 /gene="LOC108055825" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature 868..1158 /gene="LOC108055825" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" polyA_site 1328 /gene="LOC108055825" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attctcgagc tcagtgcgaa ttgtgttctc gaagcgtgtg gttcaaccgt agtagtttgt 61 agtttttctc gtttctagct gctcgccccg aaatttattt acacattccg actttcgaat 121 cagttggctc tggaattgga accgactgat tgaagtgaca gcactcgatt gtctttggcc 181 cttgtcggtt tgccagtgcc gagtagtttg tttagccttg attcgaagga gctcttcgcc 241 aggatggctg tccagccgca ggagatttcg catgccaagc gcgccgcctt tcaggttctg 301 gccggcggtt ccgctggctt cctggaggtc tgcatcatgc agccactcga tgtggtcaag 361 acccgcatcc agatccaggc cactccggcg ccaaatgccg ctgctctggg cgagctgcac 421 tacaatggtg tcttcgactg cttcgccaag atgtaccgcc acgagggcat cagctcgtac 481 tggaagggca ttatgccgcc cattctggcc gagaccccca agcgagccat aaagttcctg 541 gtgttcgagc aaacgaagcc cctcttccag ttcggctcgc ccacgcccac cccgctgacc 601 ttctcgctgg ccggtctgac ggccggcact ctggaggcca tcgccgtcaa tcccttcgag 661 gtggtcaagg tggcccagca ggcggaccgg cagaagaaga tgctcagcac gttcgcggtg 721 gccaagggca tcatcaagca ggacggactg ggctttcggg gactgaacaa gggcattacc 781 gccacgatgg ggcgcaatgg tgtcttcaac atggtgtact tcgggttcta tcacagcgtg 841 aagaacgtgg tgcccgagta caaggagaac catctggagt tcctgcgcaa ggtgaccatc 901 ggtttcctgg ccggcactct ggcctgcttc gtcaacatac cgttcgatgt ggccaagtcg 961 aggattcagg gcccacagcc ggtggccggg cagatcaagt accgcggaac gctcagctcc 1021 atgggcatcg tttatcgcga ggagggattc cgggccctgt acaagggact cgtcccgaag 1081 atcatgcgct tgggccccgg aggcgccatc ctgctgctgg tcttcgagta ctcctacgac 1141 tacctgctgc acaactactc ctagttgcca tgtcctaatg cccaattaga tattaagagg 1201 gctcccgcct gttctgtttt tttttctgtt taaaatataa ttcataggta gccgagtagt 1261 cgaacgggag tggcatttta acgctagact tccgattgtg attcgtaaat aaatgttaaa 1321 acctcaaa