Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial 2-oxodicarboxylate


LOCUS       XM_017139361            1328 bp    mRNA    linear   INV 09-DEC-2024
            carrier (LOC108055825), mRNA.
ACCESSION   XM_017139361
VERSION     XM_017139361.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139361.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1328
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1328
                     /gene="LOC108055825"
                     /note="mitochondrial 2-oxodicarboxylate carrier; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108055825"
     CDS             244..1164
                     /gene="LOC108055825"
                     /codon_start=1
                     /product="mitochondrial 2-oxodicarboxylate carrier"
                     /protein_id="XP_016994850.1"
                     /db_xref="GeneID:108055825"
                     /translation="MAVQPQEISHAKRAAFQVLAGGSAGFLEVCIMQPLDVVKTRIQI
                     QATPAPNAAALGELHYNGVFDCFAKMYRHEGISSYWKGIMPPILAETPKRAIKFLVFE
                     QTKPLFQFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQADRQKKMLSTFAVA
                     KGIIKQDGLGFRGLNKGITATMGRNGVFNMVYFGFYHSVKNVVPEYKENHLEFLRKVT
                     IGFLAGTLACFVNIPFDVAKSRIQGPQPVAGQIKYRGTLSSMGIVYREEGFRALYKGL
                     VPKIMRLGPGGAILLLVFEYSYDYLLHNYS"
     misc_feature    295..579
                     /gene="LOC108055825"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
     misc_feature    607..864
                     /gene="LOC108055825"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
     misc_feature    868..1158
                     /gene="LOC108055825"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
     polyA_site      1328
                     /gene="LOC108055825"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attctcgagc tcagtgcgaa ttgtgttctc gaagcgtgtg gttcaaccgt agtagtttgt
       61 agtttttctc gtttctagct gctcgccccg aaatttattt acacattccg actttcgaat
      121 cagttggctc tggaattgga accgactgat tgaagtgaca gcactcgatt gtctttggcc
      181 cttgtcggtt tgccagtgcc gagtagtttg tttagccttg attcgaagga gctcttcgcc
      241 aggatggctg tccagccgca ggagatttcg catgccaagc gcgccgcctt tcaggttctg
      301 gccggcggtt ccgctggctt cctggaggtc tgcatcatgc agccactcga tgtggtcaag
      361 acccgcatcc agatccaggc cactccggcg ccaaatgccg ctgctctggg cgagctgcac
      421 tacaatggtg tcttcgactg cttcgccaag atgtaccgcc acgagggcat cagctcgtac
      481 tggaagggca ttatgccgcc cattctggcc gagaccccca agcgagccat aaagttcctg
      541 gtgttcgagc aaacgaagcc cctcttccag ttcggctcgc ccacgcccac cccgctgacc
      601 ttctcgctgg ccggtctgac ggccggcact ctggaggcca tcgccgtcaa tcccttcgag
      661 gtggtcaagg tggcccagca ggcggaccgg cagaagaaga tgctcagcac gttcgcggtg
      721 gccaagggca tcatcaagca ggacggactg ggctttcggg gactgaacaa gggcattacc
      781 gccacgatgg ggcgcaatgg tgtcttcaac atggtgtact tcgggttcta tcacagcgtg
      841 aagaacgtgg tgcccgagta caaggagaac catctggagt tcctgcgcaa ggtgaccatc
      901 ggtttcctgg ccggcactct ggcctgcttc gtcaacatac cgttcgatgt ggccaagtcg
      961 aggattcagg gcccacagcc ggtggccggg cagatcaagt accgcggaac gctcagctcc
     1021 atgggcatcg tttatcgcga ggagggattc cgggccctgt acaagggact cgtcccgaag
     1081 atcatgcgct tgggccccgg aggcgccatc ctgctgctgg tcttcgagta ctcctacgac
     1141 tacctgctgc acaactactc ctagttgcca tgtcctaatg cccaattaga tattaagagg
     1201 gctcccgcct gttctgtttt tttttctgtt taaaatataa ttcataggta gccgagtagt
     1261 cgaacgggag tggcatttta acgctagact tccgattgtg attcgtaaat aaatgttaaa
     1321 acctcaaa