Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii WD repeat-containing protein wds


LOCUS       XM_017139358            1963 bp    mRNA    linear   INV 09-DEC-2024
            (wds), mRNA.
ACCESSION   XM_017139358
VERSION     XM_017139358.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139358.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1963
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1963
                     /gene="wds"
                     /note="WD repeat-containing protein wds; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108055823"
     CDS             332..1417
                     /gene="wds"
                     /codon_start=1
                     /product="protein will die slowly"
                     /protein_id="XP_016994847.1"
                     /db_xref="GeneID:108055823"
                     /translation="MVPIGAVHGGHPGVVHPPPQPLPTAPSGPNSLQPNSVGQPGATT
                     SSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAY
                     DGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVF
                     CCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSY
                     DGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCL
                     KTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCT
                     ACHPTENIIASAALENDKTIKLWKSDT"
     misc_feature    <518..1414
                     /gene="wds"
                     /note="WD40 repeat [General function prediction only];
                     Region: WD40; COG2319"
                     /db_xref="CDD:441893"
     misc_feature    554..667
                     /gene="wds"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    683..793
                     /gene="wds"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    806..916
                     /gene="wds"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    935..1042
                     /gene="wds"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1061..1171
                     /gene="wds"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1193..1306
                     /gene="wds"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1322..1402
                     /gene="wds"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     polyA_site      1963
                     /gene="wds"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttgttatt tattagagtg accataattg ttattatttt cacgtgtggc acagcgagcc
       61 aaaaaaccaa gcgcccgcta aaataaacaa agcgcaggcc gaccagaacg aagcccggtc
      121 accaccggaa acaggagcag cgcccagcgg accgcaatcg cccgaggacc acacgccacc
      181 agcgcggcgg cgttcccccc ttttcgccgg aacagcagga agaagaagca cgtgtgcggc
      241 gtgccgaaaa agaaaagaaa cgggcaaaat aaacaaggag gcgaactaag atcgggagca
      301 accagaaaac aaggagcagg aggacgaagc aatggtgccc atcggagccg tccatggcgg
      361 ccatcccggc gtagtgcatc cgccgccgca gccactgccc acggcgccca gcggtcccaa
      421 ttcgctgcag cccaattcgg tgggccagcc gggggccacc acctcctcga acagcagcgc
      481 ctccaacaag agctccctct cggtgaagcc caactacacg ctcaagttca ccctggccgg
      541 gcacaccaag gcggtctcgg cggtcaagtt tagtccgaat ggcgagtggc tggccagctc
      601 ctccgctgat aaactcatca aaatctgggg cgcctacgat ggcaagttcg agaagaccat
      661 ttcgggccac aagctgggca tcagcgatgt ggcctggagc tcggactcgc ggctcctcgt
      721 cagcggcagc gatgacaaga cgctcaaggt ctgggagctg agcaccggga agagtttgaa
      781 gacgctgaag gggcacagca actatgtgtt ctgctgcaac ttcaatccgc agtcgaatct
      841 aattgtctcc ggcagcttcg acgagagcgt tcgcatttgg gatgtgcgca ctggcaagtg
      901 cctgaagacc ctgcccgccc actcggatcc cgtttcggcg gttcacttca atcgcgacgg
      961 ctcgctgatc gtgagcagca gctacgacgg gctgtgccgc atctgggaca cggccagtgg
     1021 ccagtgcctg aagaccctga tcgacgacga caatccgccc gtgagctttg tcaaattctc
     1081 gcccaacggc aagtacatcc tggccgccac gctggacaac acgctcaagc tgtgggacta
     1141 ctcgaagggc aagtgcctga agacgtacac gggccacaag aacgagaagt actgcatatt
     1201 cgccaacttc tcggtgacgg gcggaaagtg gatcgtcagc ggcagcgagg acaacatggt
     1261 ctacatctgg aatctgcaga gcaaggaggt cgtgcagaag ctgcagggac acaccgacac
     1321 cgtgctgtgc accgcctgcc atcccacgga aaacatcatc gcttccgcgg cgctcgagaa
     1381 cgacaagacc atcaagctgt ggaagtcgga cacatagagt ggctggtatc cagctggagc
     1441 agcttcagac acatacattt cttggataaa tactatgtta aaggaaaaag tctaattata
     1501 attttaatac cctttttttt gtacacataa tttaacggag gaacccttaa attctacttt
     1561 taaatcacaa ttacaaaaac tcacattcta aggcagaaca gaaaaaccac aaaacaaaac
     1621 aaaaaaaaac acaaaaaatc ggaaaaacaa attaatgtat aaatatttat tagcctattg
     1681 tattggccac caaacaagcg agaatattcc cccaaaaatg tttgtaacct ttgacacagc
     1741 cacacaccca caaaaactta tgatgatctt tcggtgacga gaaaactaaa tttaagcaaa
     1801 acacacacac aggtgcttgg ggcaaaaccc gagcgccaga aagaatatat ataaaatacg
     1861 aaatgtaaat tttgaataaa agaaaacacg tcctcgggga cgcttgagtg tcctggcacc
     1921 ttgagcgctc ctcgaggcga gtcacttatt tgtaatagtt taa