Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii SET and MYND domain containing,


LOCUS       XM_017139347            1587 bp    mRNA    linear   INV 09-DEC-2024
            class 3 (Smyd3), mRNA.
ACCESSION   XM_017139347
VERSION     XM_017139347.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139347.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1587
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1587
                     /gene="Smyd3"
                     /note="SET and MYND domain containing, class 3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108055815"
     CDS             172..1548
                     /gene="Smyd3"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase SMYD3"
                     /protein_id="XP_016994836.2"
                     /db_xref="GeneID:108055815"
                     /translation="MASSSASKSAISAKSRSGKNAAPQIKRGQRILTEKPFAFVLKSQ
                     YRLERCDNCLEATKVLKCSNCRYVSYCHRSCQMQAWAQHKHECPFLKKVHPRIVPDAA
                     RMLCRLILRLEHGGDLIRGYYAEHGSRKFRDLMSHYAEIKNDPRRLEHLDSLHAVLSD
                     MMAESPSTVPNKTELMSIYGRLITNGFNILDAEMNSIATAIYLGVSITDHSCQPNAVA
                     TFEGNELHVHAIEDMECLDWSKVFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCTDAK
                     ESKEMLAALCPNRNCGAGISVERTNCPRCDAGISPKLRNAFNEAMTLTRHNLEHMKDV
                     AYLDVCKVCLDKQTGVFHPLNVWYVKTLDSAFEAAIEVGKWADALDYGQRLLPGFRKY
                     HGPWNPLLGLLHMKLGKIQLYENHAKEALHHLEEAQRILTVTHGRDHRLLTEQLYVLI
                     LQARHEAH"
     misc_feature    220..993
                     /gene="Smyd3"
                     /note="SET (Su(var)3-9, Enhancer-of-zeste, Trithorax)
                     domain superfamily; Region: SET; cl40432"
                     /db_xref="CDD:394802"
     misc_feature    order(220..222,784..801,823..831,898..909)
                     /gene="Smyd3"
                     /note="active site"
                     /db_xref="CDD:380914"
     misc_feature    order(220..222,787..801,904..906)
                     /gene="Smyd3"
                     /note="SAM binding site [polypeptide binding]; other site"
                     /db_xref="CDD:380914"
     misc_feature    319..432
                     /gene="Smyd3"
                     /note="MYND finger; Region: zf-MYND; pfam01753"
                     /db_xref="CDD:460312"
     misc_feature    <1108..1488
                     /gene="Smyd3"
                     /note="FxSxx-COOH system tetratricopeptide repeat protein;
                     Region: FxSxx_TPR; NF040586"
                     /db_xref="CDD:468560"
     misc_feature    <1288..1464
                     /gene="Smyd3"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:315987"
     polyA_site      1587
                     /gene="Smyd3"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttgttgcct gtgtttgcca gtcgatttgc gtaaattgtg tttgttttta gtgggctaaa
       61 aatagagatc agatgccgca aaatattcaa aaagcattcg aaacaatatt tttgatcttc
      121 aggtgtgcgc tcattttcag tcgtcagtga gacgggcccc caggcgaagc aatggccagt
      181 tcctccgcat ccaaatccgc catctcagcg aaatcgagaa gcggaaagaa tgcggctccg
      241 caaatcaaaa ggggtcagcg gatcctcacg gagaagccct ttgcctttgt cctgaagtcg
      301 cagtatcgcc tggagcgctg cgacaattgc ctggaggcaa ccaaggtgct caagtgctcc
      361 aactgccggt acgtgtccta ctgccatcgc tcctgccaga tgcaggcgtg ggcccagcac
      421 aagcacgagt gccccttcct gaagaaagtg catccgcgga tcgttccgga tgcggccagg
      481 atgctctgcc gcctgatcct gcgcctggag cacggcggcg atctcatccg gggctactac
      541 gccgagcacg gctcccgcaa gttccgcgac ctcatgtccc actatgccga aatcaagaac
      601 gatcccaggc gactggagca cctggactcg ctgcacgccg tgctcagcga catgatggcc
      661 gagagtccca gcacggtgcc gaacaagacg gaactgatga gcatttacgg tcgtctcatc
      721 accaatggct tcaatatcct agacgccgag atgaactcga ttgccacggc catttacctg
      781 ggcgtctcga tcacggacca cagctgccag ccgaatgcgg tggccacctt cgagggcaac
      841 gagctgcacg tgcacgcgat cgaggatatg gagtgtttgg actggtccaa ggtcttcatc
      901 agctacatcg atctgctgaa tacgccggag cagcggcgtc tggacctcaa ggagcactac
      961 tatttcctct gcgtctgcag caagtgcacg gacgccaagg agtccaagga gatgctggcc
     1021 gccctgtgtc ccaatcgcaa ttgtggcgcc gggatcagtg tggagcgaac gaattgcccg
     1081 cgttgcgatg ccgggatcag tcccaagctg aggaacgcgt tcaacgaggc gatgaccctc
     1141 acgcggcaca atctggagca catgaaggac gtggcctatc tggatgtttg taaggtgtgc
     1201 ctggataagc agaccggcgt ctttcatcct ttgaacgttt ggtatgtaaa gactttggac
     1261 tcggcctttg aagccgccat cgaagtgggc aagtgggccg atgctttgga ctatggacaa
     1321 cgcctgttgc cgggcttccg gaaataccac ggcccctgga atccgctgct cggcctgctg
     1381 cacatgaagc tcggcaagat ccagctgtac gagaaccacg ccaaggaggc cctgcaccat
     1441 ttggaggagg cccagcgcat cctgaccgtc acccatggcc gagatcaccg actgctcacc
     1501 gagcagctgt acgttcttat tcttcaggcc agacacgagg cgcactagca ttgttattat
     1561 tactttaaat aaagcttaag atagaga