PREDICTED: Drosophila takahashii Regulator of cullins 1a (Roc1a),

LOCUS       XM_017139312             743 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017139312
VERSION     XM_017139312.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139312.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..743
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..743
                     /gene="Roc1a"
                     /note="Regulator of cullins 1a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055793"
     CDS             127..453
                     /gene="Roc1a"
                     /codon_start=1
                     /product="RING-box protein 1A"
                     /protein_id="XP_016994801.1"
                     /db_xref="GeneID:108055793"
                     /translation="MEVDEEEFEVPSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAI
                     CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWD
                     FQKYGH"
     misc_feature    244..429
                     /gene="Roc1a"
                     /note="modified RING finger, H2 subclass (C3H2C2D-type),
                     found in RING-box protein 1 (RBX1) and similar proteins;
                     Region: mRING-H2-C3H2C2D_RBX1; cd16485"
                     /db_xref="CDD:438148"
     misc_feature    order(340..342,346..348,352..354,367..369,379..381,
                     391..393)
                     /gene="Roc1a"
                     /note="cullin binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:438148"
     polyA_site      743
                     /gene="Roc1a"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cacaccggca ggcacaccat tttcgataga ctgctcctat cgaaacggaa ctggcaaaaa
       61 acgcgaaata attgcaataa attgcaaatt ctcaggaaac cggaacaaac aggcaaaacc
      121 gcgacaatgg aggtggacga ggaagagttc gaggtgccgt cgagcagcag caagggcgag
      181 aagaagcgct tcgaggtgaa gaagtggaac gccgtggctt tgtgggcctg ggacatcgtg
      241 gtcgacaatt gcgccatttg ccgcaaccac atcatggatc tgtgcatcga gtgccaggcg
      301 aaccaggcgt ccgccaccag cgaggagtgc accgtggcct ggggcgtctg caaccacgcc
      361 ttccacttcc actgcatctc ccgctggctg aagacccgcc aggtctgccc gctggacaac
      421 cgcgagtggg acttccagaa gtacggccac taaatcggca gtcggaaatt ggaaattgga
      481 attccaggat aaccagttgg agcagcgcat caacctcacc cacacacatc cataaactcc
      541 ccccaactca aaagcctgct tcatcggaac acttaaatca tataatacct tcttagatct
      601 taagcgaatg ggccaagtcg cgagaattgg caacgatctt cgggacgcgc agagttccag
      661 ttgccaattc caacgattac cagccaacaa acagaccttt ttgtaacgca agaaataaaa
      721 gctgtagaag atggagaaga cta