PREDICTED: Drosophila takahashii Lipid droplet subset dehydrogenase

LOCUS       XM_017139258            1354 bp    mRNA    linear   INV 09-DEC-2024
            1 (Ldsdh1), mRNA.
ACCESSION   XM_017139258
VERSION     XM_017139258.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139258.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1354
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1354
                     /gene="Ldsdh1"
                     /note="Lipid droplet subset dehydrogenase 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108055765"
     CDS             138..1097
                     /gene="Ldsdh1"
                     /codon_start=1
                     /product="17-beta-hydroxysteroid dehydrogenase 13"
                     /protein_id="XP_016994747.2"
                     /db_xref="GeneID:108055765"
                     /translation="MTKVSQSAGNSNANSNDIYNIVLLVVDILLLIAKFWIAIFEAIV
                     GLFRPAPLEEVGGKVVLITGTGHGMGKQMALQYAKLGATILCWDVNEQTNNQTVKEIK
                     ANGGKAFGYVCNVTKREELIELAQKVRKEHGFVHVVVNNAGIMPCHPLLEHTESEIRL
                     MYDINVISHYWIIQSFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMS
                     ALAEELRQKNPNNNVKLTTIYPYMIDTGLCKNPRYRFPKLFKLISAEVAAGSIIEAQR
                     QGLEEAAIPRHFVAVEKIGRLIPRKAMRLVNDFLDTGVDTDKH"
     misc_feature    312..995
                     /gene="Ldsdh1"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(327..329,333..338,342..344,399..407,558..566,
                     708..716,753..755,765..767,855..866)
                     /gene="Ldsdh1"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(630..632,714..716,753..755,765..767)
                     /gene="Ldsdh1"
                     /note="active site"
                     /db_xref="CDD:187535"
     polyA_site      1354
                     /gene="Ldsdh1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actttgctga atattcagtc cgaattcgtt aacagccgct aacggtttgc tccggctgct
       61 ccgatcgtcc gcagatccct tttccctata tacacgatat atacgatcct aaaaggatat
      121 aaccaaccgc atacaaaatg acgaaagttt cgcaaagtgc tggcaacagc aatgccaaca
      181 gcaatgacat ctacaacatc gtgctgctgg tggtggacat cctgctgctg atcgccaagt
      241 tctggatcgc gatcttcgag gcgatcgtgg gcctcttccg gccggcgccc ctcgaggagg
      301 tcggcggcaa ggtggtcctg atcacgggca ctggccacgg catgggcaag cagatggccc
      361 tgcagtacgc caagctgggc gccaccattc tctgctggga cgtcaacgag cagaccaaca
      421 accagaccgt caaggagatc aaggcgaacg gcggcaaggc cttcggctat gtgtgcaatg
      481 tcacgaagcg cgaggagctg attgagttgg cccagaaggt gcgcaaggag cacggattcg
      541 tccatgtggt ggtcaacaat gccggcatca tgccctgcca tcccctgttg gagcacaccg
      601 aaagcgagat ccgtctgatg tacgacatca atgtgatctc ccactactgg atcatccagt
      661 ccttcctgcc cgacatgatt gagcgcaacg agggcagcat tgtggccctg tcctcctgcg
      721 ccggactctt tggactgatc aacctggtgc cctattgcgg caccaagttc gccgtccgcg
      781 gctacatgtc cgccctcgcc gaggagctgc gccagaagaa ccccaataac aatgtcaagc
      841 tgaccaccat ctatccgtac atgatcgaca cgggtctgtg caagaacccc cgctaccggt
      901 tccccaagct gttcaagctg atctccgcgg aggtggccgc cggctcgatc atcgaggccc
      961 agcgccaggg actggaggag gccgccattc cgcgccattt cgtcgccgtg gagaagatcg
     1021 gccgcctgat tccccgcaag gccatgcgac tggtcaacga cttcttggac acgggcgtgg
     1081 ataccgataa gcactagaag ttccagtgcc tgacactccc cgcttttccc cagtaggtca
     1141 tagagcttta ttgttttttt tccgacattt ttttttttac tattatctcc ttttaattgc
     1201 tgtgtagaga agtgcaactg agcgctctgt gaaaagtgaa tttagcaagc tcaattttgc
     1261 tgttagaaag gttgttactt aattaaaggc gcacgctgtc gggctaattg tgttggtcgt
     1321 aataaaggtc tccaaagagt actccataaa gtta