Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139254 1449 bp mRNA linear INV 09-DEC-2024 subunit beta-5 (Gbeta5), mRNA. ACCESSION XM_017139254 VERSION XM_017139254.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139254.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1449 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1449 /gene="Gbeta5" /note="guanine nucleotide-binding protein subunit beta-5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108055761" CDS 127..1203 /gene="Gbeta5" /codon_start=1 /product="guanine nucleotide-binding protein subunit beta-5" /protein_id="XP_016994743.2" /db_xref="GeneID:108055761" /translation="MSEAAVPASNANANASEKMASLVREAENLKTKLEEERQKLNDVN LSNIAERLEQIAYVNIKPRKVLKGHQAKVLCTDWSPDKRHIISSSQDGRLIIWDAFTT NKEHAVTMPTTWIMACAYAPSGNFVACGGLDNKVTVYPITSDEEMAAKKRTVGTHTSY MSCCIYPNSDQQILTGSGDSTCALWDVESGQLLQSFHGHSGDVMAIDLAPNETGNTFV SGSCDRMAFIWDMRSGHVVQSFEGHQSDVNSVKFHPCGDAIATGSDDSSCRLYDMRAD REVAVFAKESIIFGVNSVDFSVSGRLLFAGYNDYTVNLWDTLKSERVCLLYGHENKVS CVQVSPDGTALSTGSWDYTIRVWA" misc_feature 310..1200 /gene="Gbeta5" /note="WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from...; Region: WD40; cd00200" /db_xref="CDD:238121" misc_feature order(331..333,385..387,397..399,415..420,454..459, 511..513,523..525,541..546,592..597,646..648,661..663, 679..684,721..723,781..783,793..795,811..816,850..855, 907..909,919..921,937..942,973..978,1036..1038,1051..1053, 1069..1074,1108..1113,1165..1167,1177..1179,1195..1200) /gene="Gbeta5" /note="structural tetrad [active]" /db_xref="CDD:238121" misc_feature 343..456 /gene="Gbeta5" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 472..594 /gene="Gbeta5" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 607..717 /gene="Gbeta5" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 736..849 /gene="Gbeta5" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 865..975 /gene="Gbeta5" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 997..1107 /gene="Gbeta5" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1123..1197 /gene="Gbeta5" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 atcgaccacc gttgtgtatt cgtattttgt tggattcgag tatacacttt ttttcgacct 61 cctgtccatt gatttttcgc tgtccagtcg gggaagttag gaaatcctcg atccagtagc 121 accaccatgt cggaggcggc ggtgccagcg agcaatgcga acgcgaatgc cagcgagaag 181 atggccagct tggtgcggga ggcggaaaat ttaaagacga aactcgagga ggagcgccag 241 aagctgaacg acgtcaatct gtcaaatatc gcggagcgcc tcgagcagat cgcctacgtg 301 aacatcaagc cgcgcaaggt gctcaagggc caccaggcga aggtgctgtg caccgactgg 361 agtcccgaca agcggcacat catctcctcc tcgcaggacg gccgcctgat catctgggat 421 gcgttcacca cgaacaagga gcacgccgtc accatgccca ccacctggat catggcctgt 481 gcctacgccc cctcgggcaa ctttgtagcc tgcggcggac tggacaacaa ggtcaccgtt 541 tatcccatca cctcggatga ggaaatggcc gccaagaagc gcacagtggg cacccacacc 601 agctacatgt cgtgctgcat ttacccgaat tccgatcagc agattctcac cggcagcggt 661 gattccacct gcgccctgtg ggacgtggag tcgggccagc tgctccagag tttccacggc 721 cattcgggcg atgtgatggc catcgatctg gcccccaatg agacgggcaa caccttcgtc 781 tccggcagct gcgatcgcat ggccttcatc tgggacatgc gctccggcca tgtcgttcag 841 tccttcgagg gccaccagtc ggatgtgaat agcgtgaagt tccatccgtg cggcgatgcc 901 atagccaccg gttcggacga cagcagctgc cggctgtacg atatgcgggc ggatcgcgag 961 gtggccgtct tcgccaagga gagcatcatc ttcggcgtca actcggtgga cttttcggtc 1021 agcggcaggc tgctctttgc gggctacaac gattacactg tcaatctgtg ggacacgttg 1081 aaatcggagc gggtctgcct gctgtacggg cacgagaaca aggtgtcctg cgtccaggtc 1141 tcgcccgatg gcaccgccct gtccaccggc agctgggact acaccatccg ggtgtgggct 1201 taagtcctcg taagccggaa agcccattgt ttgggggcat ttgtccagga cagatgccgc 1261 ctcgctttgt ttctagtccc tcggttccat ctagtctcta cttcgttttc gttgtgcatc 1321 tctaggatag tcaatctata taatgaactc aaatatatat atatatatgt atctctttgc 1381 gtgtaaccat tatgcgacta gttgtaagtt cctgttcgaa ataaatgttg agcgatagac 1441 aagcgggtg