Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii guanine nucleotide-binding protein


LOCUS       XM_017139254            1449 bp    mRNA    linear   INV 09-DEC-2024
            subunit beta-5 (Gbeta5), mRNA.
ACCESSION   XM_017139254
VERSION     XM_017139254.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139254.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1449
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1449
                     /gene="Gbeta5"
                     /note="guanine nucleotide-binding protein subunit beta-5;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108055761"
     CDS             127..1203
                     /gene="Gbeta5"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein subunit
                     beta-5"
                     /protein_id="XP_016994743.2"
                     /db_xref="GeneID:108055761"
                     /translation="MSEAAVPASNANANASEKMASLVREAENLKTKLEEERQKLNDVN
                     LSNIAERLEQIAYVNIKPRKVLKGHQAKVLCTDWSPDKRHIISSSQDGRLIIWDAFTT
                     NKEHAVTMPTTWIMACAYAPSGNFVACGGLDNKVTVYPITSDEEMAAKKRTVGTHTSY
                     MSCCIYPNSDQQILTGSGDSTCALWDVESGQLLQSFHGHSGDVMAIDLAPNETGNTFV
                     SGSCDRMAFIWDMRSGHVVQSFEGHQSDVNSVKFHPCGDAIATGSDDSSCRLYDMRAD
                     REVAVFAKESIIFGVNSVDFSVSGRLLFAGYNDYTVNLWDTLKSERVCLLYGHENKVS
                     CVQVSPDGTALSTGSWDYTIRVWA"
     misc_feature    310..1200
                     /gene="Gbeta5"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    order(331..333,385..387,397..399,415..420,454..459,
                     511..513,523..525,541..546,592..597,646..648,661..663,
                     679..684,721..723,781..783,793..795,811..816,850..855,
                     907..909,919..921,937..942,973..978,1036..1038,1051..1053,
                     1069..1074,1108..1113,1165..1167,1177..1179,1195..1200)
                     /gene="Gbeta5"
                     /note="structural tetrad [active]"
                     /db_xref="CDD:238121"
     misc_feature    343..456
                     /gene="Gbeta5"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    472..594
                     /gene="Gbeta5"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    607..717
                     /gene="Gbeta5"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    736..849
                     /gene="Gbeta5"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    865..975
                     /gene="Gbeta5"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    997..1107
                     /gene="Gbeta5"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1123..1197
                     /gene="Gbeta5"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 atcgaccacc gttgtgtatt cgtattttgt tggattcgag tatacacttt ttttcgacct
       61 cctgtccatt gatttttcgc tgtccagtcg gggaagttag gaaatcctcg atccagtagc
      121 accaccatgt cggaggcggc ggtgccagcg agcaatgcga acgcgaatgc cagcgagaag
      181 atggccagct tggtgcggga ggcggaaaat ttaaagacga aactcgagga ggagcgccag
      241 aagctgaacg acgtcaatct gtcaaatatc gcggagcgcc tcgagcagat cgcctacgtg
      301 aacatcaagc cgcgcaaggt gctcaagggc caccaggcga aggtgctgtg caccgactgg
      361 agtcccgaca agcggcacat catctcctcc tcgcaggacg gccgcctgat catctgggat
      421 gcgttcacca cgaacaagga gcacgccgtc accatgccca ccacctggat catggcctgt
      481 gcctacgccc cctcgggcaa ctttgtagcc tgcggcggac tggacaacaa ggtcaccgtt
      541 tatcccatca cctcggatga ggaaatggcc gccaagaagc gcacagtggg cacccacacc
      601 agctacatgt cgtgctgcat ttacccgaat tccgatcagc agattctcac cggcagcggt
      661 gattccacct gcgccctgtg ggacgtggag tcgggccagc tgctccagag tttccacggc
      721 cattcgggcg atgtgatggc catcgatctg gcccccaatg agacgggcaa caccttcgtc
      781 tccggcagct gcgatcgcat ggccttcatc tgggacatgc gctccggcca tgtcgttcag
      841 tccttcgagg gccaccagtc ggatgtgaat agcgtgaagt tccatccgtg cggcgatgcc
      901 atagccaccg gttcggacga cagcagctgc cggctgtacg atatgcgggc ggatcgcgag
      961 gtggccgtct tcgccaagga gagcatcatc ttcggcgtca actcggtgga cttttcggtc
     1021 agcggcaggc tgctctttgc gggctacaac gattacactg tcaatctgtg ggacacgttg
     1081 aaatcggagc gggtctgcct gctgtacggg cacgagaaca aggtgtcctg cgtccaggtc
     1141 tcgcccgatg gcaccgccct gtccaccggc agctgggact acaccatccg ggtgtgggct
     1201 taagtcctcg taagccggaa agcccattgt ttgggggcat ttgtccagga cagatgccgc
     1261 ctcgctttgt ttctagtccc tcggttccat ctagtctcta cttcgttttc gttgtgcatc
     1321 tctaggatag tcaatctata taatgaactc aaatatatat atatatatgt atctctttgc
     1381 gtgtaaccat tatgcgacta gttgtaagtt cctgttcgaa ataaatgttg agcgatagac
     1441 aagcgggtg