Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii SDR family oxidoreductase sniffer


LOCUS       XM_017139243            1152 bp    mRNA    linear   INV 09-DEC-2024
            (sni), mRNA.
ACCESSION   XM_017139243
VERSION     XM_017139243.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139243.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1152
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1152
                     /gene="sni"
                     /note="SDR family oxidoreductase sniffer; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108055752"
     CDS             291..1034
                     /gene="sni"
                     /codon_start=1
                     /product="C-signal"
                     /protein_id="XP_016994732.2"
                     /db_xref="GeneID:108055752"
                     /translation="MNSILITGCNRGLGLGLVKALVNLPQPPQHLFTTCRNREQAKEL
                     EDLAKKHSNIHILEIDLRNFEAYDKLIADIEGVTKDQGLNVLFNNAGIAPKSARITAV
                     RSQELIDTLQTNTVVPIMLARACLPLLKKAAKANESQPMGVSRAAIINMSSILGSIQG
                     NTDGGMYAYRTSKSALNAATKSLSIDLYPQRIMCVSLHPGWVKTDMGGAAAPLDVPTS
                     TGQIVETIGRLGEQQNGGFVNYDGTPLAW"
     misc_feature    300..1031
                     /gene="sni"
                     /note="carbonyl reductase sniffer-like, classical (c)
                     SDRs; Region: carb_red_sniffer_like_SDR_c; cd05325"
                     /db_xref="CDD:187586"
     misc_feature    order(312..314,318..329,396..398,468..473,555..566,
                     627..629,741..749,795..797,807..809,882..896,900..902,
                     906..911)
                     /gene="sni"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187586"
     misc_feature    order(471..473,501..503,609..611,624..626,633..641,
                     648..650,657..662,753..773,789..791,798..803,810..815,
                     822..827,831..836,843..848,1026..1031)
                     /gene="sni"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187586"
     misc_feature    order(630..632,747..749,795..797,807..809)
                     /gene="sni"
                     /note="active site"
                     /db_xref="CDD:187586"
     polyA_site      1152
                     /gene="sni"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgaaacgcac gtttggcaat gcgccgtatc gataactctt gcggatggtt ggcaacactg
       61 ccgggcaaaa ctcagccggc cgtcggaatt tctagtttct attttccaat tttcacgcct
      121 gtgttattgc ggtgttacgg caataaagtc gcccgatatc tggttcgagg tctggtgaaa
      181 tccacagaat agtttagtaa cagtgccgcc ctttattgca ccctctttta tctcgagtgc
      241 gcgattagat tcgaggagaa acttggagat cgtctgggag cacgagcacc atgaactcca
      301 tcctgataac gggctgcaat cggggactgg gtttgggcct ggtcaaggct ctcgtaaatc
      361 ttccccagcc gccgcagcat cttttcacca cctgccggaa tcgcgagcag gcaaaggaac
      421 tggaggacct ggccaagaag cactccaaca tccacatact ggagattgat ctgaggaact
      481 ttgaggccta cgacaagcta atcgccgaca tcgagggcgt gaccaaggat cagggtctaa
      541 atgtgctttt caacaacgcc ggcatagcgc ccaaatcggc caggataacc gctgttcgct
      601 cgcaggaact aatcgacacg ctgcagacca acaccgtggt gcccatcatg ctggcccgcg
      661 cctgtctgcc gctcctgaag aaggcggcca aggccaacga gtcccagccg atgggcgtgt
      721 cgcgggccgc catcatcaac atgtcctcca ttctgggctc cattcagggc aacacagacg
      781 gcggcatgta cgcctaccgc acctccaagt cggccctgaa tgcggccacc aagtcgctga
      841 gcatcgatct ctatccgcag cgcatcatgt gcgttagcct gcatccgggc tgggtgaaaa
      901 cggacatggg tggcgccgct gcgcccctgg atgtgcccac cagcacgggc cagattgtgg
      961 agaccatcgg caggctgggc gagcagcaga acggcggttt cgtcaactac gatggcactc
     1021 cgttggcctg gtgaagattt tccctctgtt tttgttaatt gttgttgaat attaccataa
     1081 attccacttt ctggggctcc attagccatt gtattgagtg gagtacatag aaaaatatgg
     1141 ggaacacagt ga