Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139243 1152 bp mRNA linear INV 09-DEC-2024 (sni), mRNA. ACCESSION XM_017139243 VERSION XM_017139243.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139243.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1152 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1152 /gene="sni" /note="SDR family oxidoreductase sniffer; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108055752" CDS 291..1034 /gene="sni" /codon_start=1 /product="C-signal" /protein_id="XP_016994732.2" /db_xref="GeneID:108055752" /translation="MNSILITGCNRGLGLGLVKALVNLPQPPQHLFTTCRNREQAKEL EDLAKKHSNIHILEIDLRNFEAYDKLIADIEGVTKDQGLNVLFNNAGIAPKSARITAV RSQELIDTLQTNTVVPIMLARACLPLLKKAAKANESQPMGVSRAAIINMSSILGSIQG NTDGGMYAYRTSKSALNAATKSLSIDLYPQRIMCVSLHPGWVKTDMGGAAAPLDVPTS TGQIVETIGRLGEQQNGGFVNYDGTPLAW" misc_feature 300..1031 /gene="sni" /note="carbonyl reductase sniffer-like, classical (c) SDRs; Region: carb_red_sniffer_like_SDR_c; cd05325" /db_xref="CDD:187586" misc_feature order(312..314,318..329,396..398,468..473,555..566, 627..629,741..749,795..797,807..809,882..896,900..902, 906..911) /gene="sni" /note="NADP binding site [chemical binding]; other site" /db_xref="CDD:187586" misc_feature order(471..473,501..503,609..611,624..626,633..641, 648..650,657..662,753..773,789..791,798..803,810..815, 822..827,831..836,843..848,1026..1031) /gene="sni" /note="homodimer interface [polypeptide binding]; other site" /db_xref="CDD:187586" misc_feature order(630..632,747..749,795..797,807..809) /gene="sni" /note="active site" /db_xref="CDD:187586" polyA_site 1152 /gene="sni" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgaaacgcac gtttggcaat gcgccgtatc gataactctt gcggatggtt ggcaacactg 61 ccgggcaaaa ctcagccggc cgtcggaatt tctagtttct attttccaat tttcacgcct 121 gtgttattgc ggtgttacgg caataaagtc gcccgatatc tggttcgagg tctggtgaaa 181 tccacagaat agtttagtaa cagtgccgcc ctttattgca ccctctttta tctcgagtgc 241 gcgattagat tcgaggagaa acttggagat cgtctgggag cacgagcacc atgaactcca 301 tcctgataac gggctgcaat cggggactgg gtttgggcct ggtcaaggct ctcgtaaatc 361 ttccccagcc gccgcagcat cttttcacca cctgccggaa tcgcgagcag gcaaaggaac 421 tggaggacct ggccaagaag cactccaaca tccacatact ggagattgat ctgaggaact 481 ttgaggccta cgacaagcta atcgccgaca tcgagggcgt gaccaaggat cagggtctaa 541 atgtgctttt caacaacgcc ggcatagcgc ccaaatcggc caggataacc gctgttcgct 601 cgcaggaact aatcgacacg ctgcagacca acaccgtggt gcccatcatg ctggcccgcg 661 cctgtctgcc gctcctgaag aaggcggcca aggccaacga gtcccagccg atgggcgtgt 721 cgcgggccgc catcatcaac atgtcctcca ttctgggctc cattcagggc aacacagacg 781 gcggcatgta cgcctaccgc acctccaagt cggccctgaa tgcggccacc aagtcgctga 841 gcatcgatct ctatccgcag cgcatcatgt gcgttagcct gcatccgggc tgggtgaaaa 901 cggacatggg tggcgccgct gcgcccctgg atgtgcccac cagcacgggc cagattgtgg 961 agaccatcgg caggctgggc gagcagcaga acggcggttt cgtcaactac gatggcactc 1021 cgttggcctg gtgaagattt tccctctgtt tttgttaatt gttgttgaat attaccataa 1081 attccacttt ctggggctcc attagccatt gtattgagtg gagtacatag aaaaatatgg 1141 ggaacacagt ga