Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139242 1974 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_017139242 VERSION XM_017139242.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139242.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1974 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1974 /gene="Trxr1" /note="Thioredoxin reductase 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108055751" CDS 172..1647 /gene="Trxr1" /codon_start=1 /product="thioredoxin reductase 1, mitochondrial isoform X2" /protein_id="XP_016994731.1" /db_xref="GeneID:108055751" /translation="MAPVQGTYDYDLIVIGGGSAGLACAKEAVLNGARVACLDYVKPT PTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWNKLVQS VQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGG RPRYPDIPGAVEHGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVR SIVLRGFDQQMAELVASSMEERGIPFLRKSVPLSVEKQDDGKLLVKYKNTETGEEAED VFDTVLWAIGRKGLVDDLNLPNAGVSVQKDKIPVDSQEATNVANIYAVGDIIYGKPEL TPVAVLAGRLLARRLYGGATQRMDYKDVATTVFTPLEYACVGLSEEDAVKQYGADEVE VFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYLGPVAGEVIQGFAAALKS GLTINTLINTVGIHPTTAEEFTRLSITKRSGLDPTPASCCS" misc_feature 193..1641 /gene="Trxr1" /note="thioredoxin and glutathione reductase selenoprotein; Region: TGR; TIGR01438" /db_xref="CDD:273624" polyA_site 1974 /gene="Trxr1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atttattcga gctttcgcga gtgccgccgc ttaaacacgc tcactagttt tcgattctcg 61 accgcccgca actgtttttc ccacttccgc cactactgca acatttacta cccgacgttg 121 atccttgttt tcgctcttat ttacctcgag aagctaccaa aaacacagat aatggcgccc 181 gtgcaaggaa cctacgacta cgacctaatt gtgattggcg gcggatcagc tggcctggcc 241 tgcgccaagg aggcggtgct caacggagcc cgcgtggcct gcctggacta cgtcaagccc 301 acgcccacgc tgggcaccaa gtggggcgtt ggcggcacct gcgtgaacgt cggctgcatt 361 cccaagaagc tgatgcacca ggcctccctc ctcggcgagg ctgtccacga ggcagcagcc 421 tatggctgga acgtggacga caagatcaag cccgactgga acaagctggt gcagtccgtg 481 cagaaccaca tcaaatccgt caactgggtg acccgcgtgg atctgcgcga caagaaagtg 541 gagtacatca atggactcgg ctccttcgtg gactcgcaca ccctgctggc caagctgaag 601 agcggcgagc gcacaatcac cgcccagacc tttgtcatcg ccgtgggcgg ccgtccccgc 661 tatccggata ttcccggagc cgtggagcac ggcatcacca gcgatgatct gttcagtttg 721 gaccgcgagc ccggcaagac cttggttgtg ggagctggct acattggcct cgagtgcgct 781 ggattcctga agggtctcgg ctacgagccc accgtcatgg tgcgctccat tgtgctgcgc 841 ggcttcgacc agcagatggc cgagctggtg gcctcctcga tggaggagcg cggcattccc 901 ttcctgcgca aatcggtgcc cctgtcggtg gagaagcagg acgacggcaa gctgctggtc 961 aagtacaaga acacggagac cggcgaggag gccgaggatg tcttcgacac cgtgctgtgg 1021 gccattggcc gcaagggcct ggtcgacgat ctgaatttgc ccaatgccgg cgtgagtgtg 1081 cagaaggaca agattccagt ggactcgcag gaggccacca atgtggcgaa catctatgcc 1141 gtgggcgaca ttatctacgg caagccggag ctgacgcccg tggccgtttt ggccggtcgt 1201 ctgctggccc gccgcctcta cggcggagcc acgcagcgca tggactacaa ggatgtggcc 1261 accacggtgt ttacgcctct ggaatacgcc tgcgtcggtc tgagcgagga ggatgccgtc 1321 aagcagtacg gagccgacga ggtggaggta ttccacggct actacaagcc cacggagttc 1381 ttcattccgc agaagagcgt gcgctactgc tacttgaagg cggtggccga gcgccacggc 1441 gaccagcgcg tctacggact ccactacctc ggcccggtgg ccggtgaggt gatccaggga 1501 ttcgcggccg ccctcaagtc cggcctgacc atcaacacgc tgatcaacac cgtgggcatt 1561 caccccacga ccgccgagga gttcacccgg ctgagcatca ccaagcgctc gggattggac 1621 cccacgccgg ccagctgctg cagctaaggc gggattgcag ctcagccgcg aagacccgaa 1681 gatgatgaat ggttgttaga cgcggcccag cgatcgaaga gttcaacagt tccgtttcag 1741 tttccacaca attaacaaca cccacacaat agctctgcgc aagggagggg caccgggcag 1801 cgatgacggg cggaactcca gcggagcgac cagtcccctg gctgcgacca gcccatccca 1861 cgactgctgc gccgccgaca tgcactcaaa attttgaatt tgtttgaacc tatgaaatta 1921 accatgaaac cccctaaatg tatggttgaa aaatataatt tttcaccgac aaaa