Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Thioredoxin reductase 1 (Trxr1),


LOCUS       XM_017139242            1974 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_017139242
VERSION     XM_017139242.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139242.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1974
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1974
                     /gene="Trxr1"
                     /note="Thioredoxin reductase 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108055751"
     CDS             172..1647
                     /gene="Trxr1"
                     /codon_start=1
                     /product="thioredoxin reductase 1, mitochondrial isoform
                     X2"
                     /protein_id="XP_016994731.1"
                     /db_xref="GeneID:108055751"
                     /translation="MAPVQGTYDYDLIVIGGGSAGLACAKEAVLNGARVACLDYVKPT
                     PTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWNKLVQS
                     VQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGG
                     RPRYPDIPGAVEHGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVR
                     SIVLRGFDQQMAELVASSMEERGIPFLRKSVPLSVEKQDDGKLLVKYKNTETGEEAED
                     VFDTVLWAIGRKGLVDDLNLPNAGVSVQKDKIPVDSQEATNVANIYAVGDIIYGKPEL
                     TPVAVLAGRLLARRLYGGATQRMDYKDVATTVFTPLEYACVGLSEEDAVKQYGADEVE
                     VFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYLGPVAGEVIQGFAAALKS
                     GLTINTLINTVGIHPTTAEEFTRLSITKRSGLDPTPASCCS"
     misc_feature    193..1641
                     /gene="Trxr1"
                     /note="thioredoxin and glutathione reductase
                     selenoprotein; Region: TGR; TIGR01438"
                     /db_xref="CDD:273624"
     polyA_site      1974
                     /gene="Trxr1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atttattcga gctttcgcga gtgccgccgc ttaaacacgc tcactagttt tcgattctcg
       61 accgcccgca actgtttttc ccacttccgc cactactgca acatttacta cccgacgttg
      121 atccttgttt tcgctcttat ttacctcgag aagctaccaa aaacacagat aatggcgccc
      181 gtgcaaggaa cctacgacta cgacctaatt gtgattggcg gcggatcagc tggcctggcc
      241 tgcgccaagg aggcggtgct caacggagcc cgcgtggcct gcctggacta cgtcaagccc
      301 acgcccacgc tgggcaccaa gtggggcgtt ggcggcacct gcgtgaacgt cggctgcatt
      361 cccaagaagc tgatgcacca ggcctccctc ctcggcgagg ctgtccacga ggcagcagcc
      421 tatggctgga acgtggacga caagatcaag cccgactgga acaagctggt gcagtccgtg
      481 cagaaccaca tcaaatccgt caactgggtg acccgcgtgg atctgcgcga caagaaagtg
      541 gagtacatca atggactcgg ctccttcgtg gactcgcaca ccctgctggc caagctgaag
      601 agcggcgagc gcacaatcac cgcccagacc tttgtcatcg ccgtgggcgg ccgtccccgc
      661 tatccggata ttcccggagc cgtggagcac ggcatcacca gcgatgatct gttcagtttg
      721 gaccgcgagc ccggcaagac cttggttgtg ggagctggct acattggcct cgagtgcgct
      781 ggattcctga agggtctcgg ctacgagccc accgtcatgg tgcgctccat tgtgctgcgc
      841 ggcttcgacc agcagatggc cgagctggtg gcctcctcga tggaggagcg cggcattccc
      901 ttcctgcgca aatcggtgcc cctgtcggtg gagaagcagg acgacggcaa gctgctggtc
      961 aagtacaaga acacggagac cggcgaggag gccgaggatg tcttcgacac cgtgctgtgg
     1021 gccattggcc gcaagggcct ggtcgacgat ctgaatttgc ccaatgccgg cgtgagtgtg
     1081 cagaaggaca agattccagt ggactcgcag gaggccacca atgtggcgaa catctatgcc
     1141 gtgggcgaca ttatctacgg caagccggag ctgacgcccg tggccgtttt ggccggtcgt
     1201 ctgctggccc gccgcctcta cggcggagcc acgcagcgca tggactacaa ggatgtggcc
     1261 accacggtgt ttacgcctct ggaatacgcc tgcgtcggtc tgagcgagga ggatgccgtc
     1321 aagcagtacg gagccgacga ggtggaggta ttccacggct actacaagcc cacggagttc
     1381 ttcattccgc agaagagcgt gcgctactgc tacttgaagg cggtggccga gcgccacggc
     1441 gaccagcgcg tctacggact ccactacctc ggcccggtgg ccggtgaggt gatccaggga
     1501 ttcgcggccg ccctcaagtc cggcctgacc atcaacacgc tgatcaacac cgtgggcatt
     1561 caccccacga ccgccgagga gttcacccgg ctgagcatca ccaagcgctc gggattggac
     1621 cccacgccgg ccagctgctg cagctaaggc gggattgcag ctcagccgcg aagacccgaa
     1681 gatgatgaat ggttgttaga cgcggcccag cgatcgaaga gttcaacagt tccgtttcag
     1741 tttccacaca attaacaaca cccacacaat agctctgcgc aagggagggg caccgggcag
     1801 cgatgacggg cggaactcca gcggagcgac cagtcccctg gctgcgacca gcccatccca
     1861 cgactgctgc gccgccgaca tgcactcaaa attttgaatt tgtttgaacc tatgaaatta
     1921 accatgaaac cccctaaatg tatggttgaa aaatataatt tttcaccgac aaaa