Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Companion of reaper (Corp), mRNA.


LOCUS       XM_017139236             935 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139236
VERSION     XM_017139236.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139236.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..935
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..935
                     /gene="Corp"
                     /note="Companion of reaper; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108055749"
     CDS             142..783
                     /gene="Corp"
                     /codon_start=1
                     /product="uncharacterized protein Corp"
                     /protein_id="XP_016994725.2"
                     /db_xref="GeneID:108055749"
                     /translation="MMEDTRSRLKILFQGKTHLITCGSSNTYEEVISQAMSQFDIPEG
                     QRSALILTNGKDYVFEEHLLEYFLLLFPCPEITFHLRFDWSKMRRSLSKTEFESLKRK
                     RPVEQDQVEEQEKEEPVPEYKPVPVYRMNCFLGSLPSAGGAPVHRQNCFLREQSQQLE
                     EIALPRLRDEDLQQQQQEPQKKRLRLDVCAKSRRTASASVVPSAVPMKRAIRI"
     polyA_site      935
                     /gene="Corp"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caacagttgc ttgcactcat tcgatcggca actttccaag cgaacgcacc gcggctcaaa
       61 gtgatagtaa aaagaagaga ttaagatcaa tacaacattc aattcaattc actccacgaa
      121 acaaaacaaa agcaacggat aatgatggag gacaccagga gccgcttgaa gatccttttc
      181 cagggcaaaa cacacctcat cacttgcgga tcctccaaca cctacgaaga ggtcatctcc
      241 caagccatgt cccaattcga cattccggag ggtcaaagga gtgccctgat cctgaccaac
      301 ggcaaggact acgtgttcga ggagcacttg ctggagtact tcctgctact gttcccctgc
      361 cccgagatca ccttccacct gaggttcgac tggtccaaga tgcgcaggag tctgagcaag
      421 accgagttcg agtcgctcaa gcgaaagcgt cccgtggaac aggatcaggt cgaggagcag
      481 gaaaaggagg agccggtgcc ggagtacaag ccggtgccgg tctaccggat gaactgcttc
      541 ctgggatcgc tgcccagtgc aggaggcgcc cccgtgcatc gccagaactg cttcctccgg
      601 gaacagtcgc agcagctgga ggagattgcc ctgccacgac tgcgcgacga ggatctccag
      661 cagcagcagc aggagccgca gaagaagcgc cttcgcttgg acgtctgcgc caagtcgaga
      721 cgcactgcgt ccgcctcagt ggttccgtcc gccgttccca tgaagcgcgc cattcgcata
      781 tagatcgccg atcagcattt gtacatagct atagtacgta tacgatactc cacttaaatt
      841 ctagttataa gctaaagggt tgaaccactg ttcctaagac taacactata cctatcacac
      901 caaataaacg tccaaaccaa atgttatatt atgta