Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139236 935 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017139236 VERSION XM_017139236.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139236.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..935 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..935 /gene="Corp" /note="Companion of reaper; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108055749" CDS 142..783 /gene="Corp" /codon_start=1 /product="uncharacterized protein Corp" /protein_id="XP_016994725.2" /db_xref="GeneID:108055749" /translation="MMEDTRSRLKILFQGKTHLITCGSSNTYEEVISQAMSQFDIPEG QRSALILTNGKDYVFEEHLLEYFLLLFPCPEITFHLRFDWSKMRRSLSKTEFESLKRK RPVEQDQVEEQEKEEPVPEYKPVPVYRMNCFLGSLPSAGGAPVHRQNCFLREQSQQLE EIALPRLRDEDLQQQQQEPQKKRLRLDVCAKSRRTASASVVPSAVPMKRAIRI" polyA_site 935 /gene="Corp" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caacagttgc ttgcactcat tcgatcggca actttccaag cgaacgcacc gcggctcaaa 61 gtgatagtaa aaagaagaga ttaagatcaa tacaacattc aattcaattc actccacgaa 121 acaaaacaaa agcaacggat aatgatggag gacaccagga gccgcttgaa gatccttttc 181 cagggcaaaa cacacctcat cacttgcgga tcctccaaca cctacgaaga ggtcatctcc 241 caagccatgt cccaattcga cattccggag ggtcaaagga gtgccctgat cctgaccaac 301 ggcaaggact acgtgttcga ggagcacttg ctggagtact tcctgctact gttcccctgc 361 cccgagatca ccttccacct gaggttcgac tggtccaaga tgcgcaggag tctgagcaag 421 accgagttcg agtcgctcaa gcgaaagcgt cccgtggaac aggatcaggt cgaggagcag 481 gaaaaggagg agccggtgcc ggagtacaag ccggtgccgg tctaccggat gaactgcttc 541 ctgggatcgc tgcccagtgc aggaggcgcc cccgtgcatc gccagaactg cttcctccgg 601 gaacagtcgc agcagctgga ggagattgcc ctgccacgac tgcgcgacga ggatctccag 661 cagcagcagc aggagccgca gaagaagcgc cttcgcttgg acgtctgcgc caagtcgaga 721 cgcactgcgt ccgcctcagt ggttccgtcc gccgttccca tgaagcgcgc cattcgcata 781 tagatcgccg atcagcattt gtacatagct atagtacgta tacgatactc cacttaaatt 841 ctagttataa gctaaagggt tgaaccactg ttcctaagac taacactata cctatcacac 901 caaataaacg tccaaaccaa atgttatatt atgta