Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139191 1087 bp mRNA linear INV 09-DEC-2024 (LOC108055734), mRNA. ACCESSION XM_017139191 VERSION XM_017139191.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139191.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1087 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1087 /gene="LOC108055734" /note="uncharacterized LOC108055734; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108055734" CDS 156..1001 /gene="LOC108055734" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016994680.2" /db_xref="GeneID:108055734" /translation="MASNPTQTLHQAIQAKFGLPNASEATQLSSTGGTPPQTTPRFVI PQLKIPQLQLQAASSAESRQAAEAHNQLLLNEIQLRRRQRSESENKGGFGIPPLAAEP PNIPNIPNIPLLARLDQLQLRDEGGDPPLIDLSSTVIAGSKDAPPKESASKARQLISS RETFDIPFIACDRGNSRRTTPTGGLLAHRRRSEEEPEEAPARTDYPEQPGPIGQMLDA VVGYPEPRKPRLEYAVTRLERQHLRMCRREEYGSQVKRFRFDTPSPDELVKQALQKSW RVSRT" polyA_site 1087 /gene="LOC108055734" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gctacttgac aaccctgccc ccccatacaa cgtcacctca cacacacaca cacacacaca 61 cacggcgcgc gaagaaaaca ataacaaacg agaaggctaa acaaaaaagt gaaaattcgt 121 catcaaaggc tggaatcttg gcccaaaacc caaagatggc cagcaatccg acgcagaccc 181 tccaccaggc gatccaggcc aagtttggcc tgcccaacgc cagcgaagcc acccaattga 241 gcagcacagg cggcacgccc ccacaaacga cgcccagatt cgtaattccg cagctgaaaa 301 ttccgcaact gcaactgcaa gcggcatcgt cggcggaatc ccgtcaagcg gcggaggccc 361 acaaccagct gctgctcaac gagatccagc tgcggcgacg ccagcgatcg gagagcgaga 421 acaagggggg cttcgggatt cccccgctgg cagcggagcc cccgaatatc cctaatattc 481 cgaatattcc gcttctggcg cggctggatc agctgcagct gcgggacgag ggcggcgatc 541 cgccgctcat cgatctctcg tccaccgtga tagccggcag caaggatgcg ccgcccaagg 601 agtcggccag caaggcgcgt cagctaatta gcagccggga aaccttcgac atacccttca 661 ttgcctgcga tcgcggaaat tccaggagga ccactcccac cggtggcctc ctggcccaca 721 ggcggcgttc ggaggaggag ccggaggagg cgcccgcccg caccgactat ccggagcagc 781 cgggacccat tggccaaatg ctggacgctg tagtgggcta tccggagccg aggaagccac 841 ggctggagta cgccgtcacc cggctggagc ggcagcatct gaggatgtgc cggcgggagg 901 agtacggcag ccaggtgaag agattccgct tcgacacgcc ctcgcccgat gagctcgtca 961 agcaggcgct gcagaagtcc tggcgcgttt cgcgcacttg acttcagttg cagttgcagt 1021 cgcatccttt agttgacaat taccgaaaag taaaatcaaa acaataaatc tactaagttc 1081 aaaagca