Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017139191            1087 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108055734), mRNA.
ACCESSION   XM_017139191
VERSION     XM_017139191.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139191.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1087
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1087
                     /gene="LOC108055734"
                     /note="uncharacterized LOC108055734; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108055734"
     CDS             156..1001
                     /gene="LOC108055734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016994680.2"
                     /db_xref="GeneID:108055734"
                     /translation="MASNPTQTLHQAIQAKFGLPNASEATQLSSTGGTPPQTTPRFVI
                     PQLKIPQLQLQAASSAESRQAAEAHNQLLLNEIQLRRRQRSESENKGGFGIPPLAAEP
                     PNIPNIPNIPLLARLDQLQLRDEGGDPPLIDLSSTVIAGSKDAPPKESASKARQLISS
                     RETFDIPFIACDRGNSRRTTPTGGLLAHRRRSEEEPEEAPARTDYPEQPGPIGQMLDA
                     VVGYPEPRKPRLEYAVTRLERQHLRMCRREEYGSQVKRFRFDTPSPDELVKQALQKSW
                     RVSRT"
     polyA_site      1087
                     /gene="LOC108055734"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gctacttgac aaccctgccc ccccatacaa cgtcacctca cacacacaca cacacacaca
       61 cacggcgcgc gaagaaaaca ataacaaacg agaaggctaa acaaaaaagt gaaaattcgt
      121 catcaaaggc tggaatcttg gcccaaaacc caaagatggc cagcaatccg acgcagaccc
      181 tccaccaggc gatccaggcc aagtttggcc tgcccaacgc cagcgaagcc acccaattga
      241 gcagcacagg cggcacgccc ccacaaacga cgcccagatt cgtaattccg cagctgaaaa
      301 ttccgcaact gcaactgcaa gcggcatcgt cggcggaatc ccgtcaagcg gcggaggccc
      361 acaaccagct gctgctcaac gagatccagc tgcggcgacg ccagcgatcg gagagcgaga
      421 acaagggggg cttcgggatt cccccgctgg cagcggagcc cccgaatatc cctaatattc
      481 cgaatattcc gcttctggcg cggctggatc agctgcagct gcgggacgag ggcggcgatc
      541 cgccgctcat cgatctctcg tccaccgtga tagccggcag caaggatgcg ccgcccaagg
      601 agtcggccag caaggcgcgt cagctaatta gcagccggga aaccttcgac atacccttca
      661 ttgcctgcga tcgcggaaat tccaggagga ccactcccac cggtggcctc ctggcccaca
      721 ggcggcgttc ggaggaggag ccggaggagg cgcccgcccg caccgactat ccggagcagc
      781 cgggacccat tggccaaatg ctggacgctg tagtgggcta tccggagccg aggaagccac
      841 ggctggagta cgccgtcacc cggctggagc ggcagcatct gaggatgtgc cggcgggagg
      901 agtacggcag ccaggtgaag agattccgct tcgacacgcc ctcgcccgat gagctcgtca
      961 agcaggcgct gcagaagtcc tggcgcgttt cgcgcacttg acttcagttg cagttgcagt
     1021 cgcatccttt agttgacaat taccgaaaag taaaatcaaa acaataaatc tactaagttc
     1081 aaaagca