PREDICTED: Drosophila takahashii gastrula zinc finger protein

LOCUS       XM_017139183             550 bp    mRNA    linear   INV 09-DEC-2024
            XlCGF44.2 (LOC108055728), mRNA.
ACCESSION   XM_017139183
VERSION     XM_017139183.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139183.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..550
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..550
                     /gene="LOC108055728"
                     /note="gastrula zinc finger protein XlCGF44.2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108055728"
     CDS             83..550
                     /gene="LOC108055728"
                     /codon_start=1
                     /product="gastrula zinc finger protein XlCGF44.2"
                     /protein_id="XP_016994672.2"
                     /db_xref="GeneID:108055728"
                     /translation="MSAERPTPQLDDGRLMCEFCGYRTGIPWNLQIHRRRHTGEKPFS
                     CDTCHARFPASYQLKNHLERHLDAGQRRLRHICTDCNVGFSSSRALYHHRPLHEDLKR
                     FRCSQCDKSFAQAAGYAQHKRMHRQRNQRATRELKNLEDQQDVQDAQVIQDTK"
     misc_feature    131..193
                     /gene="LOC108055728"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(146..148,152..154,158..160,164..169,176..181,
                     188..190,230..232,236..238,248..253,260..265,272..274,
                     326..328,332..334,338..340,344..349,356..361,368..370)
                     /gene="LOC108055728"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    215..277
                     /gene="LOC108055728"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    311..373
                     /gene="LOC108055728"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    395..457
                     /gene="LOC108055728"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275370"
ORIGIN      
        1 ggccaaatgc caagtggtag gttgtaaatc ggtgcatcta acaatagtgc cggcgtttag
       61 atttggcact cgctgggcga ccatgtcggc ggaacgtcca actccgcagt tggatgacgg
      121 gcgactgatg tgcgagttct gcggctatcg cacgggaatc ccttggaatc tgcaaatcca
      181 tcggcggcgt cacaccggcg agaagccctt cagctgcgac acctgccacg ctcgttttcc
      241 ggccagttat cagctgaaga accacctgga gcggcacttg gacgccggac aacggcgcct
      301 tcggcacatc tgcaccgatt gcaatgtggg cttctccagt tcccgggccc tctaccatca
      361 taggccgctc cacgaggatc tcaagcgatt caggtgctcg cagtgtgaca aatcgtttgc
      421 ccaggcggcg ggttacgcgc aacacaagcg gatgcaccgc cagaggaatc agcgggccac
      481 acgggaactc aagaacctcg aggatcagca ggatgtgcag gatgcgcagg ttattcaaga
      541 tacaaagtaa