Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017138874 783 bp mRNA linear INV 09-DEC-2024 (LOC108055507), mRNA. ACCESSION XM_017138874 VERSION XM_017138874.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017138874.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..783 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..783 /gene="LOC108055507" /note="uncharacterized LOC108055507; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108055507" CDS 97..708 /gene="LOC108055507" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016994363.2" /db_xref="GeneID:108055507" /translation="MNRRTAFGLPIWTPLFILFLLFLASAWGKPSSLVVNRQGLLDMY HRQVHGSKKEMECPGEGLLDVKHHRFDRSMNPFKAFLSWPGKQRKMEKIQPVKEDSYG HEEMSKYSYEEPIIENKMDRYLAQDDELDFQPKLGLLDHEYAEHFDENLDMDMFDSFQ PVKSKLINSPMMDYKREFASDEANPYVESLQQRYEPSPYAFKD" polyA_site 783 /gene="LOC108055507" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctatacgttt tccagtccga aaccaaccgg actctgttgt ctatcagaat aatattttca 61 agtaattata tttagatatt taaatacata tcgaagatga atagaaggac tgcctttgga 121 ctgcccattt ggacgccgct gttcatcctc ttcttgcttt tcctggccag cgcctggggt 181 aagccgtcgt cgcttgtggt gaatcgccag ggtttgctgg acatgtacca tcgacaggtt 241 catggatcta aaaaggaaat ggaatgccca ggggagggac tattggatgt caaacatcat 301 cgtttcgatc ggtcaatgaa tcctttcaaa gcctttcttt cgtggcccgg caagcagcga 361 aaaatggaga aaattcagcc agttaaagag gattcgtatg gccacgaaga gatgtcgaaa 421 tacagctacg aggagccgat aattgagaat aaaatggatc gctatttggc ccaggatgat 481 gagttggact tccaaccaaa gctggggctg ctggatcatg agtatgcgga acactttgac 541 gagaatctcg acatggacat gtttgacagc tttcaacccg ttaaatccaa gttgattaac 601 agtcccatga tggactacaa acgggaattc gccagcgatg aggccaatcc ctatgtggag 661 agccttcagc agcgttatga gccctcgcca tatgccttta aggattaatc cttaatatat 721 tttttatgcg ttctttagct gtgatttcag cgatcaatta aagataactt tctgttggaa 781 aca