Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii metaxin-2 (LOC108055506), mRNA.


LOCUS       XM_017138873            1190 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017138873
VERSION     XM_017138873.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017138873.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1190
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1190
                     /gene="LOC108055506"
                     /note="metaxin-2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108055506"
     CDS             98..979
                     /gene="LOC108055506"
                     /codon_start=1
                     /product="metaxin-2"
                     /protein_id="XP_016994362.2"
                     /db_xref="GeneID:108055506"
                     /translation="MNLEQNLTAALMQSQSLGKEAAAEEEAWPAEAHLHQPPEESQLL
                     LPERSSCLAVKTYLRMCGLPFSERISENAEFMSPGGRLTHLPLLRLGPVRTFAEFEPI
                     VAQVEAMQAGSSLGSWMTQDQRDDVRCLVGHVENVFTLAEIHMSFVDAVNYQRYTAPR
                     TGQPHPWPLSVMRRITRQREAQRLLKVYQWQEMDHDQVLHEVGLCADALVAQLEESQE
                     AKEEGAGFLCGSRPCALDALVFGHVAAILTTQMPNMELAAILGTYPRLLAHCRRIDGR
                     LFEGKLLSVEEQLEYPE"
     misc_feature    194..421
                     /gene="LOC108055506"
                     /note="The thioredoxin (TRX)-like superfamily is a large,
                     diverse group of proteins containing a TRX fold. Many
                     members contain a classic TRX domain with a redox active
                     CXXC motif. They function as protein disulfide
                     oxidoreductases (PDOs), altering the redox...; Region:
                     Protein Disulfide Oxidoreductases and Other Proteins with
                     a Thioredoxin fold; cl00388"
                     /db_xref="CDD:469754"
     misc_feature    518..919
                     /gene="LOC108055506"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:470672"
     misc_feature    order(521..523,542..544,797..799,806..811,818..820,
                     830..832)
                     /gene="LOC108055506"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     misc_feature    order(521..526,533..538,545..547,719..721)
                     /gene="LOC108055506"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198286"
     misc_feature    order(542..544,554..559,821..823,830..832)
                     /gene="LOC108055506"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198286"
ORIGIN      
        1 acagccacaa ctgtcatctc tacctcaacg accctatttt gctggccccg aaaacgaaac
       61 cccattgaat ttagtccaaa tttccggcac tttaaccatg aacttggagc aaaacctgac
      121 cgctgccctg atgcagtcgc agtcgctggg caaggaggcg gcggcggagg aggaggcgtg
      181 gccggcggag gcccatctgc accagccgcc cgaagagagt cagttgctct tgccggagcg
      241 ttccagctgc ctggcggtga agacctatct gcggatgtgc ggcctgccct tttcggagcg
      301 gatcagcgag aatgcggagt tcatgtcgcc cggcggtcgc ctcacccacc tgccactgct
      361 ccgtttgggc cccgtaagga cctttgccga gttcgagccc attgtcgccc aggtggaggc
      421 catgcaggcg ggcagctcgc tgggcagctg gatgacgcag gatcagcgcg acgatgtccg
      481 ctgcctggtg ggccatgtgg agaatgtctt cacgctggcc gagatccaca tgagcttcgt
      541 ggacgccgtc aactatcaac ggtacacggc accgcgcact ggacagccgc atccctggcc
      601 cttgagtgtg atgcgccgga ttacgaggca gcgggaggcc cagcggctgc tgaaggtcta
      661 ccagtggcag gagatggacc acgaccaggt gctccacgag gtgggtctgt gtgccgacgc
      721 gctggtcgcc caactggagg agagccagga ggcaaaggag gagggcgccg gcttcctctg
      781 cggctcgcga ccctgcgccc tggacgccct ggtctttggc catgtggctg ccatactgac
      841 cacccagatg cccaatatgg agctggccgc gatcctcggc acctatcccc gcctcctcgc
      901 ccattgtcgg cgcatcgatg gccgcttgtt cgagggcaag ctcctcagcg tcgaggagca
      961 gctggagtat cccgagtagt cgggggtaac caggagtagg gggtcgacgg gaagccaatc
     1021 aaaaatatgc aaagcattta caataaaaac ggcagacgag ccaaaggagt ggggtgggct
     1081 ttccgagggg agtggagcgg agcaagtgga gccggagata agccagcgca caatgccata
     1141 aaatacagca acagacaagg cgaacgctga gagaaaaact tgaaaaagtg