Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017138870 426 bp mRNA linear INV 09-DEC-2024 (LOC108055502), mRNA. ACCESSION XM_017138870 VERSION XM_017138870.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017138870.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..426 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..426 /gene="LOC108055502" /note="uncharacterized LOC108055502; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108055502" CDS 55..393 /gene="LOC108055502" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016994359.2" /db_xref="GeneID:108055502" /translation="MLRQSLTLILILWIAVCCFSAELPGNAYLPPLRNNYQVSDESLL DDDNDNGFLFDIDQDSYERYAPVFVDYPGIHQLLRQQQEYALDLPLEGKPYERKVPDL NNDAAVKRHW" ORIGIN 1 cgaactgcaa ttcgggtctc agcacagttg aagccctcga ccgaagttac caagatgctg 61 agacaatctt tgaccctgat tctgatcctc tggattgccg tttgttgttt ctcggcggaa 121 ttgcccggaa atgcctactt gccaccgctg aggaataact accaagtttc cgatgaatcc 181 ttattagacg acgacaatga caatggattt ctcttcgata ttgaccagga ctcctacgaa 241 cggtatgccc ccgtctttgt ggactatccg gggatccacc aacttctaag acagcaacag 301 gaatacgcct tggatctgcc ccttgaagga aagccatatg aacggaaagt tccagatctt 361 aataacgatg cggctgtcaa aagacattgg tagaggtttt tacgaaacaa ttgaacagta 421 aataaa