Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017138870             426 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108055502), mRNA.
ACCESSION   XM_017138870
VERSION     XM_017138870.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017138870.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..426
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..426
                     /gene="LOC108055502"
                     /note="uncharacterized LOC108055502; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108055502"
     CDS             55..393
                     /gene="LOC108055502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016994359.2"
                     /db_xref="GeneID:108055502"
                     /translation="MLRQSLTLILILWIAVCCFSAELPGNAYLPPLRNNYQVSDESLL
                     DDDNDNGFLFDIDQDSYERYAPVFVDYPGIHQLLRQQQEYALDLPLEGKPYERKVPDL
                     NNDAAVKRHW"
ORIGIN      
        1 cgaactgcaa ttcgggtctc agcacagttg aagccctcga ccgaagttac caagatgctg
       61 agacaatctt tgaccctgat tctgatcctc tggattgccg tttgttgttt ctcggcggaa
      121 ttgcccggaa atgcctactt gccaccgctg aggaataact accaagtttc cgatgaatcc
      181 ttattagacg acgacaatga caatggattt ctcttcgata ttgaccagga ctcctacgaa
      241 cggtatgccc ccgtctttgt ggactatccg gggatccacc aacttctaag acagcaacag
      301 gaatacgcct tggatctgcc ccttgaagga aagccatatg aacggaaagt tccagatctt
      361 aataacgatg cggctgtcaa aagacattgg tagaggtttt tacgaaacaa ttgaacagta
      421 aataaa