Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017138486 5531 bp mRNA linear INV 09-DEC-2024 variant X2, mRNA. ACCESSION XM_017138486 VERSION XM_017138486.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017138486.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5531 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..5531 /gene="Nrg" /note="Neuroglian; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:108055215" CDS 361..4263 /gene="Nrg" /codon_start=1 /product="neuroglian isoform X1" /protein_id="XP_016993975.2" /db_xref="GeneID:108055215" /translation="MWRQSTILAALLVALITGCAAVKSNSPPRITKQPAPGELLFKVA QQNKESDNPFIIECEADAQPEPEYSWVKNGKKFDWQAYDNRMLRQPGRGTLVITIPKD EDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEMPKTLEAVEGEPFMLKCAAPDGF PSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFR SEYKIGNKVLLDVKQMGVSASQNKHQPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQ TVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNV NSVPYFTKEPDFQTAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQTPPNPRRTVTDN TIRIVNLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTIEVPPSDVSSVDGRNITI KCRVKGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEI QADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFEA QPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITC QADKAEIQWEPQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWAN YTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIE HNAPNFHYYVSWKRDIPAASWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDKGES NVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQTW TENEGEEGLREIHVKGDTHNALVTQFKPDSKNFARILAYNGRFNGPPSAVIDFDTPEG VPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHIT DPRVTRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAINVAPATPSFSWEQ LPSDNGLAKFRINWQPSQEGHPGTHFFTMYRIKGETQWLRKDEEKNSDYQEVSGLDPD TAYEFRVVSVDGHFNTESATQEIDTNTVEGPIIQPNETVANAGWFIGMMLALAFIIIL FIIICIIRRNRGGKYDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANKP GVESDTDSMAEYGDGDTGQFTEDGSFIGQYVPGKLQPPVSPQPLNNSAAAHQPAPTAG GGGGSEAAGPSGSSGGAVAGGASASNGGAAAGAVATYV" misc_feature 442..741 /gene="Nrg" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 520..534 /gene="Nrg" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409396" misc_feature 559..573 /gene="Nrg" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409396" misc_feature 637..651 /gene="Nrg" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409396" misc_feature 679..696 /gene="Nrg" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409396" misc_feature 721..732 /gene="Nrg" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409396" misc_feature 793..1005 /gene="Nrg" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 808..822 /gene="Nrg" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409557" misc_feature 850..864 /gene="Nrg" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409557" misc_feature 931..945 /gene="Nrg" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409557" misc_feature 982..999 /gene="Nrg" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409557" misc_feature 1108..1353 /gene="Nrg" /note="Immunoglobulin domain; Region: ig; pfam00047" /db_xref="CDD:395002" misc_feature 1150..1161 /gene="Nrg" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1186..1200 /gene="Nrg" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1255..1269 /gene="Nrg" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1297..1314 /gene="Nrg" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1339..1350 /gene="Nrg" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409353" misc_feature 1372..1638 /gene="Nrg" /note="Fourth immunoglobulin (Ig)-like domain of hemolin, and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_hemolin-like; cd20978" /db_xref="CDD:409570" misc_feature 1372..1383 /gene="Nrg" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409570" misc_feature 1399..1410 /gene="Nrg" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409570" misc_feature 1423..1446 /gene="Nrg" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 1462..1479 /gene="Nrg" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 1486..1494 /gene="Nrg" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409570" misc_feature 1516..1530 /gene="Nrg" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409570" misc_feature 1534..1548 /gene="Nrg" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1573..1599 /gene="Nrg" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1606..1638 /gene="Nrg" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409570" misc_feature 1651..1908 /gene="Nrg" /note="Immunoglobulin I-set domain; Region: I-set; pfam07679" /db_xref="CDD:400151" misc_feature 1702..1716 /gene="Nrg" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409358" misc_feature 1741..1755 /gene="Nrg" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409358" misc_feature 1804..1818 /gene="Nrg" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409358" misc_feature 1846..1863 /gene="Nrg" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409358" misc_feature 1885..1896 /gene="Nrg" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409358" misc_feature 1918..2202 /gene="Nrg" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 1969..1983 /gene="Nrg" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409359" misc_feature 2014..2028 /gene="Nrg" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409359" misc_feature 2086..2100 /gene="Nrg" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409359" misc_feature 2128..2145 /gene="Nrg" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409359" misc_feature 2167..2178 /gene="Nrg" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409359" misc_feature 2194..2478 /gene="Nrg" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2443..2448,2452..2457) /gene="Nrg" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2503..2778 /gene="Nrg" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2749..2754,2758..2763) /gene="Nrg" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2806..3072 /gene="Nrg" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature order(3058..3063,3067..3072) /gene="Nrg" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature order(3106..3108,3316..3318,3361..3363) /gene="Nrg" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature 3109..3378 /gene="Nrg" /note="Fibronectin type III domain; Region: fn3; pfam00041" /db_xref="CDD:394996" misc_feature 3478..3663 /gene="Nrg" /note="Fibronectin type 3 domain; Region: FN3; smart00060" /db_xref="CDD:214495" misc_feature order(3667..3672,3676..3681) /gene="Nrg" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 3820..4074 /gene="Nrg" /note="Bravo-like intracellular region; Region: Bravo_FIGEY; pfam13882" /db_xref="CDD:464016" polyA_site 5531 /gene="Nrg" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgatgttttt gaaagtatcg cgcaaagtat cgcccaaatg tacaccccag gccaaattcc 61 catccgttct cattcaattt tttaatttcg actcgcgctg ctgtgctccg ttgttgcaac 121 agaacagcag aaagtaataa aagctcggct cgcatgcaat tttcattagt gggaaaattg 181 cttgatattt aagaggcaac cgaggaacaa accgaatcaa cagcagcagc agcaggcaga 241 cagacacaca cattccaaac taaattaata ataggaaaaa aataaaagtt aaagccaaaa 301 caaaccaaaa ccaaacgaaa cacaatcgag ggcgcgagcg gagtgccaga aacgacgaaa 361 atgtggcggc agtcaacgat actggccgcg ttattagtgg ctcttataac gggctgtgca 421 gcagtcaaaa gcaactcccc accaagaatc accaaacaac cggcacccgg agaactgctc 481 ttcaaagtag cgcaacagaa taaggaaagt gacaatccat ttattatcga atgcgaagcc 541 gatgcacaac ccgaaccaga atatagttgg gtgaagaatg gcaagaagtt cgactggcag 601 gcgtacgaca accggatgct gcgacagcct ggccgcggca ccctggtgat caccataccc 661 aaggacgagg atcgcggcca ctaccagtgc tttgcgtcca acgaattcgg aacggcgacc 721 tcgaactcgg tgtatgtgcg caaggcggag ctgaatgcct tcaaggacga gatgcccaag 781 actttggagg cggtggaggg cgagcccttc atgctcaagt gtgccgcccc cgatggcttt 841 cccagtccga ccgtcaactg gatgatccag gagtccatcg acggcagcat caagtcgatc 901 aacaactcgc gcatgaccct cgatcccgag ggcaatctct ggttctcgaa cgtgacccgc 961 gaggatgcca gctcggactt ctactacgcc tgctcggcca cctccgtttt ccgcagcgag 1021 tacaagatcg gcaacaaggt gctgctcgac gtcaagcaga tgggcgtgag tgcctcgcag 1081 aacaaacacc agcccgtccg ccagtatgtt tcgcgtcgcc agtcgctggc gctgcgcggc 1141 aagcgcatgg aactcttctg catctacggc ggcactccgc tgccgcagac cgtctggagc 1201 aaggatggcc agcggataca gtggagcgac aggatcaccc agggacacta cggcaagtcg 1261 ctggtcatca ggcagacgaa cttcgacgat gccggcacct acacctgcga cgtctcgaac 1321 ggcgtcggca atgcccagtc cttctcgatc atcctcaatg tcaactcggt gccgtatttc 1381 accaaggaac ccgacttcca gaccgccgcc gaggacgagg aggtggtctt cgagtgccgc 1441 gccgccggtg tgcccgagcc gaagatcagt tggattcaca atggcaagcc catcgagcag 1501 acgccaccga atccccggcg aaccgtcacg gacaacacga tccggatcgt taatctggtc 1561 aagggcgata cgggtaacta cggctgcaac gccaccaact cgctgggcta cgtctacaag 1621 gatgtctatc tgaatgtcca ggccgagccg ccaaccattg aagttccccc ctcggacgtc 1681 tccagtgtgg atgggcgaaa catcacgatc aagtgccgcg tgaagggatc ccccaagccg 1741 ctggtcaagt ggctgagggc cagcaactgg ctgaccggcg gtcgctacaa tgttcaggct 1801 aacggcgatc tggagatcca ggacgtgacc ttctcggatg ccggcaagta cacgtgctat 1861 gcgcagaaca agttcggtga gatccaggcg gacgggtcgc tggtggtcaa ggagcacacg 1921 cgcatcaccc aggagccgca gaactacgag gtggccgccg gacagtcggc cacattccgc 1981 tgcaacgagg cgcacgacga tacgctggag atcgagatcg attggtggaa ggacgggcag 2041 tcgattgact ttgaggcgca gccgcgtttc gtgaagacca acgacaattc gctgaccatt 2101 gccaagacca tggagctgga ttcgggcgag tatacgtgtg tggcgaggac gcgactggat 2161 gaggcaacgg ccagggccaa tttgattgtc caggatgtgc cgaatgcccc aaaactaacg 2221 ggcatcacct gccaggcgga caaggcggag attcagtggg agccgcaggg cgacaaccgc 2281 tcgcccattc tgcactacac cattcagttt aatacgagct tcacgcccgc ctcgtgggat 2341 gccgcgtacg agaaggtgcc caatacggac tcctccttcg ttgtccaaat gtcgccgtgg 2401 gccaactaca cgttccgtgt gatcgccttc aacaagatcg gtgcctcgcc gccgtcggcg 2461 cacagcgaca gctgcaccac ccagccggat gtgcccttca agaatcccga caatgtcgtc 2521 ggccagggca ccgagccgaa taatctggtc atctcgtgga ctcccatgcc cgagatcgag 2581 cacaatgcgc ccaatttcca ttactacgtg agctggaaac gcgacattcc ggcggcgtcg 2641 tgggagaata acaacatctt tgactggcga cagaacaaca ttgtgatcgc cgatcagccg 2701 acgttcgtca agtatctgat caaggtggtg gccatcaacg acaagggcga atcgaatgtg 2761 gccgccgagg aggtggtcgg ctattccggc gaggatcgtc ccctggacgc gcccaccaac 2821 tttacgatgc gacagatcac ctcgtcgacc agcggctata tggcctggac accggtgagc 2881 gaggagtcgg tgaggggtca cttcaagggc tacaagatcc agacgtggac ggagaacgag 2941 ggcgaggagg gtctgcggga gatccatgtg aagggcgata cgcacaacgc cctggtcacc 3001 cagtttaagc ccgactcgaa gaactttgcc cgcatcctgg cctacaacgg tcgcttcaat 3061 gggccgccca gtgcggtcat cgatttcgat acacccgagg gtgtgccgtc gccggtccag 3121 ggattggatg cctatccact gggctcctcg gccttcatgc tgcactggaa gaagccgctg 3181 tatcccaatg gcaagctcac cggctacaag atctactacg aggaggtcaa ggagagctat 3241 gtgggcgagc ggcgggagta cgatccccat atcaccgatc ccagggtcac gcgcatgaag 3301 atggccggtc tgaagcccaa ctccaagtat cgcatctcca tcacggccac cacgaaaatg 3361 ggcgagggat ctgagcacta catcgagaag acgacgctga aggacgccat caatgtggcc 3421 ccggccacgc cctcattctc ctgggagcaa ctgccctccg acaatggact ggccaagttc 3481 cgcatcaact ggcagccaag tcaggaaggt cacccgggca ctcacttctt caccatgtac 3541 aggatcaagg gcgaaaccca gtggctgcgc aaggacgagg agaagaactc cgactaccag 3601 gaggttagcg gcctggatcc agacaccgcc tacgagttcc gcgtggtctc cgtcgatggg 3661 cacttcaata cggagagtgc cacgcaggag atcgacacga acaccgtcga gggaccgatc 3721 atacagccca acgagacggt ggcgaatgca ggttggttca tcggcatgat gctggccctg 3781 gccttcatca ttatcctgtt catcatcatc tgcattatcc ggcgcaatcg gggcggcaag 3841 tacgacgttc acgatcggga gctggccaac ggccggcggg attatcccga agagggcggc 3901 ttccacgagt actcgcaacc gttggataac aagagcgctg gtcgccaatc cgtgagttca 3961 gcgaacaaac ccggcgtgga aagcgacacc gattcgatgg ccgaatacgg tgatggcgac 4021 acaggacaat tcaccgagga cggctccttc attggccagt atgttcccgg caagctgcag 4081 ccgccggtca gtccacagcc gctgaacaac tccgctgcgg cgcatcagcc ggcgccaact 4141 gccggcggag gaggaggatc ggaggcagcc ggcccatcgg gatcttcagg aggagccgtt 4201 gcaggaggag cctcggccag caatggagga gctgctgccg gagccgtggc cacctacgtc 4261 taagaggcta aggtggctgg cactcatcat ttgcccccct gttctcctga ttttcttcga 4321 aacgattcaa acgcccccta aaaccaaaaa caaaaaaaac tttgtgtaat tctatgtgta 4381 aaacgaaaac tgctttaagt gtctgcaaaa aatgaaacaa cattataatt atataaaaaa 4441 cgaaaacaat tgtaaagtga agagaaaaac tcgcatgaat ttaaagcata taattttgct 4501 tcttttggct tataaaatta ttctagcaaa cagttgaacg ccttttcaag aaaaaaaaaa 4561 ccaaaaactt ttgtataagc ttaaaaaaaa gaaaaccaaa aatgaatgta aacgttaaaa 4621 aaaaatgtat ggggaagaag aaaaagaaca attaataatg aagcctgttt gtgtaataat 4681 tttttttaca aaaataccct ttagttacta gtggcacaag gattattatg tctaaatgga 4741 aaccaagtcg agggatcgag agggaatgga ggcaatagcg acggatgttc aggatatatc 4801 atcgattgca gtctaatcta aactaagatc tgttcaacat gtacaaaaac caaggcttag 4861 accagaacca tcgggcagct tcgatcaatg actgactgaa ttgcgaagat aatgccttga 4921 ctattttgca atcaatttac agtacagtac agtacattta cgactaacca aatacgacta 4981 caaatatcga tgtgttcaat tagcagcaag tcaaatgttc aacttgacct cgattacttt 5041 tcgccacaat caaagacttt aagggcagag cagattttcc agggccagtt cgtcggcaat 5101 tcgtatatat tgtatatcgt ataagttccg attttcgtcc atagtctaat gcaatttttc 5161 gtattcgcgt atagtgttta aaccccaaac agaatccctt cattttgtcc attaattctt 5221 taagtaaagc aaattagtta attaacaaat tagttgaccc gaaccactgg cacgtggcgg 5281 tcattgtaac ctacctatta taatacgcag ctaaaaacct aaaaacctat aacctataac 5341 ccacaattgt tccacaagta ctccctcatt tatttgaatg gaaatgttga aaccacttaa 5401 tccagatatc tgtaataata accatgtatt cataattttt ttttaaacta aaaactaaaa 5461 cacacaaagt ggcattagaa tctaaacaca aacaaacaca ataaaataaa tgaaaaacaa 5521 agacataaaa a