Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017138104             817 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054965), mRNA.
ACCESSION   XM_017138104
VERSION     XM_017138104.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017138104.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..817
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..817
                     /gene="LOC108054965"
                     /note="uncharacterized LOC108054965; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108054965"
     CDS             169..537
                     /gene="LOC108054965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016993593.2"
                     /db_xref="GeneID:108054965"
                     /translation="MSDYSKFLSNLTDQLGLLPGLSSKGFEGLGNLGNLGNLGNLGNN
                     LGNLRPAHKALMCVGAATVACVVLGLTVKSLRGRGRKDDKRRIIKVLSGAPIKRDLEG
                     SVKDDGAAGEGNVLVVDSAH"
     polyA_site      817
                     /gene="LOC108054965"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtaaagcagg ctgcgagccc agaattgaca aacgtcagac tttcccacca gctctatttc
       61 attatatttt ctgctgtagt tcacatcaca accagtttcg gctgaaaaat aatattaaaa
      121 atagcaaaaa tatttcccca aggaaattct acggtattgg tattcaggat gtcggactat
      181 tcaaagtttc tgtccaactt gacggatcag ctgggcctgc tgccgggact ttcttcaaaa
      241 ggattcgaag gactgggaaa cctgggcaac ttgggcaacc tgggcaactt gggcaacaat
      301 ctgggcaacc tgcgccccgc ccacaaggct ctgatgtgcg tgggcgcggc caccgtggcc
      361 tgcgttgtcc tcggtctcac tgtcaagtcc ttgagggggc gtggccgcaa ggatgacaaa
      421 cggaggatca tcaaggtgct aagcggagca ccgatcaagc gtgaccttga ggggtctgtc
      481 aaggacgacg gggccgctgg ggaggggaac gtcttagtgg tagacagtgc tcattaagaa
      541 ttggaggatc aagcccgaag gagcccccat atgagccaca cgtcccacgg aaattaatcc
      601 cccttcacca ccacatcacc acataaatgc tataaacctg ttttgtgcgt tgctacgttc
      661 tctgtatatt ttgtaatttt ataccgtttt caaaagcggt tatacaaata acatgttcaa
      721 aattttataa atgcccattc acataccatc attttcgaaa cataacagcc cacaaatttc
      781 atctttgtaa taaactattc agtttaacca ccttaaa