Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017138079 678 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017138079 VERSION XM_017138079.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017138079.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..678 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..678 /gene="Ilp7" /note="Insulin-like peptide 7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108054954" CDS 82..561 /gene="Ilp7" /codon_start=1 /product="probable insulin-like peptide 7" /protein_id="XP_016993568.2" /db_xref="GeneID:108054954" /translation="MCKMILPNTGSWTLCGAVLLFVLPLIPTPEALQHTEEGLEMLFR ERSQSDWENVWHQEAHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKSST DPDGSTWLHVNYANMFLRSRRADGHAPSISNECCTKAGCTWEEYAEYCPSNKRRNHY" misc_feature 256..531 /gene="Ilp7" /note="IlGF_like family, relaxin_like subgroup, specific to vertebrates. Members include a number of active peptides including (pro)relaxin, mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP; gene INSL4); Region: IlGF_relaxin_like; cd04365" /db_xref="CDD:239831" misc_feature order(274..276,286..288,295..297) /gene="Ilp7" /note="receptor binding surface [active]" /db_xref="CDD:239831" polyA_site 678 /gene="Ilp7" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagtcgccac gcgtcctccg tgtgagccac accaggatcg aaagtccaaa gtccatagtc 61 ccggccggga ggatccgaaa aatgtgcaag atgatactac ccaacacggg cagctggacg 121 ctttgcggcg ccgtcctcct gttcgtcctg ccgctgatcc ccacgccgga ggcactgcag 181 cacacggagg agggtctcga gatgctgttc cgcgagcgtt cccaatcgga ctgggagaac 241 gtgtggcacc aggaggcgca ctcccgctgc cgggacaagc tcgtccgtca gctttactgg 301 gcctgcgaga aggacattta ccgactgacg cggcgcaaca aaaagaggac gggcaacgac 361 gaggcctgga tcaaaaagag ctccacggac cctgatggct ccacctggct gcacgtgaac 421 tatgccaata tgttcctgag aagtcgccga gcggatggtc atgccccatc gatctcgaat 481 gagtgctgca caaaggcggg ctgcacttgg gaggagtacg ccgagtactg tccttcgaac 541 aaacgacgca atcactattg attcgccagc aacgtgggat ccgcttagat atataaaacc 601 atataaatat attcgctttt ttttcgtggt tgttgttgat gttcttgttg tggtgaaata 661 aactcttaat gaaaagaa