Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Insulin-like peptide 7 (Ilp7),


LOCUS       XM_017138079             678 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017138079
VERSION     XM_017138079.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017138079.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..678
                     /gene="Ilp7"
                     /note="Insulin-like peptide 7; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:108054954"
     CDS             82..561
                     /gene="Ilp7"
                     /codon_start=1
                     /product="probable insulin-like peptide 7"
                     /protein_id="XP_016993568.2"
                     /db_xref="GeneID:108054954"
                     /translation="MCKMILPNTGSWTLCGAVLLFVLPLIPTPEALQHTEEGLEMLFR
                     ERSQSDWENVWHQEAHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKSST
                     DPDGSTWLHVNYANMFLRSRRADGHAPSISNECCTKAGCTWEEYAEYCPSNKRRNHY"
     misc_feature    256..531
                     /gene="Ilp7"
                     /note="IlGF_like family, relaxin_like subgroup, specific
                     to vertebrates. Members include a number of active
                     peptides including (pro)relaxin, mammalian Leydig
                     cell-specific insulin-like peptide (gene INSL3), early
                     placenta insulin-like peptide (ELIP; gene INSL4); Region:
                     IlGF_relaxin_like; cd04365"
                     /db_xref="CDD:239831"
     misc_feature    order(274..276,286..288,295..297)
                     /gene="Ilp7"
                     /note="receptor binding surface [active]"
                     /db_xref="CDD:239831"
     polyA_site      678
                     /gene="Ilp7"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagtcgccac gcgtcctccg tgtgagccac accaggatcg aaagtccaaa gtccatagtc
       61 ccggccggga ggatccgaaa aatgtgcaag atgatactac ccaacacggg cagctggacg
      121 ctttgcggcg ccgtcctcct gttcgtcctg ccgctgatcc ccacgccgga ggcactgcag
      181 cacacggagg agggtctcga gatgctgttc cgcgagcgtt cccaatcgga ctgggagaac
      241 gtgtggcacc aggaggcgca ctcccgctgc cgggacaagc tcgtccgtca gctttactgg
      301 gcctgcgaga aggacattta ccgactgacg cggcgcaaca aaaagaggac gggcaacgac
      361 gaggcctgga tcaaaaagag ctccacggac cctgatggct ccacctggct gcacgtgaac
      421 tatgccaata tgttcctgag aagtcgccga gcggatggtc atgccccatc gatctcgaat
      481 gagtgctgca caaaggcggg ctgcacttgg gaggagtacg ccgagtactg tccttcgaac
      541 aaacgacgca atcactattg attcgccagc aacgtgggat ccgcttagat atataaaacc
      601 atataaatat attcgctttt ttttcgtggt tgttgttgat gttcttgttg tggtgaaata
      661 aactcttaat gaaaagaa