Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii lamin-1-like (LOC108054947), mRNA.


LOCUS       XM_017138070            1059 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017138070
VERSION     XM_017138070.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017138070.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1059
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1059
                     /gene="LOC108054947"
                     /note="lamin-1-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 11 Proteins"
                     /db_xref="GeneID:108054947"
     CDS             1..1059
                     /gene="LOC108054947"
                     /codon_start=1
                     /product="lamin-1-like"
                     /protein_id="XP_016993559.2"
                     /db_xref="GeneID:108054947"
                     /translation="MLKLAYFVLSALIILDVYGSLAHPQDKGGSVCQLNDPPNQCAQF
                     CLTRLQPMIENIPETKTKLDRIQGEQQAIQTKLVAVQSRLEAQRSGFQIELDAHLQAV
                     QNKVEVLQTDIQKKLDSQLLAVQTKLEGQLKELLLAVEKKLDDQKTSFHDSFEVRLNR
                     TEGELQDLQTKLDEKLLDERKTITKQDFEVRMNRTEGQLQNLQEKIVGQLGAFQATLQ
                     ETRSKNNLKAKSPKFQRIASRYFYIENNMELDHFAAGVACREMGGNLASIKDEEELNG
                     IAVRSVRDTWYHLSINNLDKEGVFVSETTGKLATYFKWRSGYPGNSIGCVQLYNGGMG
                     IYGCTDKVNFICQSDDEI"
     misc_feature    139..618
                     /gene="LOC108054947"
                     /note="Apolipoprotein A1/A4/E domain; Region:
                     Apolipoprotein; pfam01442"
                     /db_xref="CDD:460211"
     misc_feature    712..1041
                     /gene="LOC108054947"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgcttaagc tggcatattt cgttttgagc gccctaatta tcctggatgt ttatggatca
       61 ttggcgcatc cccaggataa aggaggttcc gtttgccaac taaacgatcc tccgaaccag
      121 tgcgctcaat tctgcctcac aagactgcaa ccgatgatcg aaaacattcc cgaaaccaag
      181 acaaagctgg accggattca aggcgaacag caggcaattc agaccaaact cgtggcggtg
      241 caatccaggc tggaggccca gcgatcggga tttcaaatcg agttggatgc ccatcttcaa
      301 gccgttcaga ataaagtgga agtcctgcag acggacattc agaaaaagct ggatagccaa
      361 cttctggcgg ttcagaccaa gctggaggga caacttaagg agttacttct tgcagtagag
      421 aaaaagctgg acgaccagaa aacatctttc cacgactcct ttgaggtgag attaaacagg
      481 actgaaggag aattgcagga tcttcagacc aagctggatg aaaaacttct ggatgaacgg
      541 aagaccatta caaagcaaga ttttgaggtc agaatgaaca ggacggaagg acaactgcag
      601 aatcttcagg aaaaaattgt aggccaacta ggagcctttc aggcaactct ccaggaaacc
      661 cgatccaaaa ataatttaaa agccaaatcg cctaaatttc aacggatcgc ctcgaggtac
      721 ttctatattg aaaataatat ggagctagat cattttgcgg ctggtgtcgc ctgtcgtgaa
      781 atgggcggaa acttggcgtc aattaaagac gaagaggaat taaatggtat tgccgtgagg
      841 agcgtaagag acacatggta tcaccttagc atcaacaacc tggacaaaga gggcgttttt
      901 gtatctgaga ccacagggaa gctagccaca tattttaagt ggagatcagg atatcccggt
      961 aactctatag gctgcgttca gctatacaat ggaggaatgg gtatatatgg ctgtacggat
     1021 aaggtaaatt ttatttgtca gtcagacgat gaaatataa