Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii lysozyme (LOC108054946), mRNA.


LOCUS       XM_017138069             603 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017138069
VERSION     XM_017138069.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017138069.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..603
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..603
                     /gene="LOC108054946"
                     /note="lysozyme; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 Proteins"
                     /db_xref="GeneID:108054946"
     CDS             16..471
                     /gene="LOC108054946"
                     /codon_start=1
                     /product="lysozyme"
                     /protein_id="XP_016993558.2"
                     /db_xref="GeneID:108054946"
                     /translation="MRAVSFGSWLWLGLGLLFISSDFSVVFAKRFLRCELARKLLNQH
                     GFERSLLSNWICLLEHESDLETGKITTNVNGSRNYGLFQINSRFCQEGRRGGICNVKC
                     EDLLDENLTESATCAKRIQTSDGFRHWGGWQRYCRNTQNLPNLKVICGI"
     misc_feature    100..453
                     /gene="LOC108054946"
                     /note="C-type invertebrate lysozyme; Region: LYZ_C_invert;
                     cd16899"
                     /db_xref="CDD:381618"
     polyA_site      603
                     /gene="LOC108054946"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcatccagtt gcaccatgag agctgtgtcg ttcggatcgt ggctctggct gggattgggt
       61 ttgcttttca tcagcagcga tttcagcgta gtttttgcca agaggttcct gcgctgcgaa
      121 ctagcccgca aactgctcaa ccagcatggc ttcgaacgaa gtctgctttc aaattggatc
      181 tgcttgctgg agcatgagag cgacctggag actggaaaaa ttaccacgaa tgtgaatgga
      241 tctcgaaact acgggttgtt tcaaatcaac agtagatttt gtcaagaagg aaggcgcggt
      301 ggcatttgca atgtcaagtg cgaagatctt ctggatgaaa atttaacgga atcagcaact
      361 tgtgccaagc gcattcagac ctcagatggt tttcgtcact ggggtggatg gcaacgctac
      421 tgccgcaaca cccagaattt gcctaatctt aaagtcatct gtgggatttg atttaatagg
      481 tttataaatt tagttttata actaaataat ataatcggac ggcagtaaaa ctatacacct
      541 gtaatacata caactgcaaa aaaaaaagat aataaaatat taaaaatatt tttcgccagg
      601 gta