Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017138069 603 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017138069 VERSION XM_017138069.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017138069.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..603 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..603 /gene="LOC108054946" /note="lysozyme; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108054946" CDS 16..471 /gene="LOC108054946" /codon_start=1 /product="lysozyme" /protein_id="XP_016993558.2" /db_xref="GeneID:108054946" /translation="MRAVSFGSWLWLGLGLLFISSDFSVVFAKRFLRCELARKLLNQH GFERSLLSNWICLLEHESDLETGKITTNVNGSRNYGLFQINSRFCQEGRRGGICNVKC EDLLDENLTESATCAKRIQTSDGFRHWGGWQRYCRNTQNLPNLKVICGI" misc_feature 100..453 /gene="LOC108054946" /note="C-type invertebrate lysozyme; Region: LYZ_C_invert; cd16899" /db_xref="CDD:381618" polyA_site 603 /gene="LOC108054946" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcatccagtt gcaccatgag agctgtgtcg ttcggatcgt ggctctggct gggattgggt 61 ttgcttttca tcagcagcga tttcagcgta gtttttgcca agaggttcct gcgctgcgaa 121 ctagcccgca aactgctcaa ccagcatggc ttcgaacgaa gtctgctttc aaattggatc 181 tgcttgctgg agcatgagag cgacctggag actggaaaaa ttaccacgaa tgtgaatgga 241 tctcgaaact acgggttgtt tcaaatcaac agtagatttt gtcaagaagg aaggcgcggt 301 ggcatttgca atgtcaagtg cgaagatctt ctggatgaaa atttaacgga atcagcaact 361 tgtgccaagc gcattcagac ctcagatggt tttcgtcact ggggtggatg gcaacgctac 421 tgccgcaaca cccagaattt gcctaatctt aaagtcatct gtgggatttg atttaatagg 481 tttataaatt tagttttata actaaataat ataatcggac ggcagtaaaa ctatacacct 541 gtaatacata caactgcaaa aaaaaaagat aataaaatat taaaaatatt tttcgccagg 601 gta