Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial ribosomal protein


LOCUS       XM_017137892             713 bp    mRNA    linear   INV 09-DEC-2024
            L30 (mRpL30), mRNA.
ACCESSION   XM_017137892
VERSION     XM_017137892.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137892.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..713
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..713
                     /gene="mRpL30"
                     /note="mitochondrial ribosomal protein L30; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108054812"
     CDS             94..636
                     /gene="mRpL30"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL30m"
                     /protein_id="XP_016993381.2"
                     /db_xref="GeneID:108054812"
                     /translation="MNLGRLLTPLRSSTWSVRSYGKHNKKFLYKDGQKFEGITYYPRT
                     SDHQDPPVEPAKLFRVQRIKPVKGNPYWEKRILKDLGLDGKQSDFTVVKNIPENNARL
                     WKVKHLVKVTPVTFPYGEPTAQDVRHTILKENGECLVTRDLGAIESRLEARREYDEQP
                     RRLDTDLLRKDARLKWLNPW"
     misc_feature    265..426
                     /gene="mRpL30"
                     /note="Ribosomal protein L30, which is found in eukaryotes
                     and prokaryotes but not in archaea, is one of the smallest
                     ribosomal proteins with a molecular mass of about 7kDa.
                     L30 binds the 23SrRNA as well as the 5S rRNA and is one of
                     five ribosomal proteins that...; Region:
                     Ribosomal_L30_like; cl00203"
                     /db_xref="CDD:469654"
     misc_feature    order(280..288,304..312,316..321,325..336,343..357,
                     379..396,400..405,409..417)
                     /gene="mRpL30"
                     /note="23S rRNA binding site - archaea [nucleotide
                     binding]; other site"
                     /db_xref="CDD:100100"
     misc_feature    order(283..288,304..309,316..321,328..336,343..345,
                     352..354,367..372,379..387,391..396)
                     /gene="mRpL30"
                     /note="23S rRNA binding site - prokaryotes [nucleotide
                     binding]; other site"
                     /db_xref="CDD:100100"
     misc_feature    order(400..405,409..417)
                     /gene="mRpL30"
                     /note="5S rRNA binding site - archaea; other site"
                     /db_xref="CDD:100100"
     polyA_site      713
                     /gene="mRpL30"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttagagtga ccacttggaa taatttcata acagcagcga ggaggctgtt tttatttatt
       61 gcaatattaa aacaattaat ataatcactt agaatgaacc tcggtcgcct gctgaccccg
      121 ctgaggagca gcacctggtc ggtgcgcagc tatggaaagc acaacaagaa gttcctgtac
      181 aaggacgggc agaaattcga gggaatcacc tactatccca ggacctcgga tcaccaggat
      241 ccgcccgtgg agccggcgaa actcttccgg gtgcagcgca tcaagccggt gaagggtaat
      301 ccctactggg agaagcgaat cctcaaggat ctgggcctcg atggcaagca gagcgacttc
      361 acggtggtca agaacatccc ggagaataac gcgcgcctgt ggaaggtcaa gcacttggtt
      421 aaggtcaccc cggtgacgtt tccctacgga gaacccaccg cccaggacgt tcggcacacg
      481 atactcaagg agaacggcga gtgcctggtc accagggacc tgggagccat cgagagccgc
      541 ctggaggcgc gacgggagta cgatgaacag ccccggcgac tggacaccga cctgctgcgc
      601 aaggatgccc gcctcaagtg gctgaatccc tggtagttaa atgcccgttc actttattcc
      661 ttaaaatatt ttaaaaaaat acacaaaaaa cacttcgtgg aggaggcatc aca