Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137892 713 bp mRNA linear INV 09-DEC-2024 L30 (mRpL30), mRNA. ACCESSION XM_017137892 VERSION XM_017137892.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137892.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..713 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..713 /gene="mRpL30" /note="mitochondrial ribosomal protein L30; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108054812" CDS 94..636 /gene="mRpL30" /codon_start=1 /product="large ribosomal subunit protein uL30m" /protein_id="XP_016993381.2" /db_xref="GeneID:108054812" /translation="MNLGRLLTPLRSSTWSVRSYGKHNKKFLYKDGQKFEGITYYPRT SDHQDPPVEPAKLFRVQRIKPVKGNPYWEKRILKDLGLDGKQSDFTVVKNIPENNARL WKVKHLVKVTPVTFPYGEPTAQDVRHTILKENGECLVTRDLGAIESRLEARREYDEQP RRLDTDLLRKDARLKWLNPW" misc_feature 265..426 /gene="mRpL30" /note="Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that...; Region: Ribosomal_L30_like; cl00203" /db_xref="CDD:469654" misc_feature order(280..288,304..312,316..321,325..336,343..357, 379..396,400..405,409..417) /gene="mRpL30" /note="23S rRNA binding site - archaea [nucleotide binding]; other site" /db_xref="CDD:100100" misc_feature order(283..288,304..309,316..321,328..336,343..345, 352..354,367..372,379..387,391..396) /gene="mRpL30" /note="23S rRNA binding site - prokaryotes [nucleotide binding]; other site" /db_xref="CDD:100100" misc_feature order(400..405,409..417) /gene="mRpL30" /note="5S rRNA binding site - archaea; other site" /db_xref="CDD:100100" polyA_site 713 /gene="mRpL30" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttagagtga ccacttggaa taatttcata acagcagcga ggaggctgtt tttatttatt 61 gcaatattaa aacaattaat ataatcactt agaatgaacc tcggtcgcct gctgaccccg 121 ctgaggagca gcacctggtc ggtgcgcagc tatggaaagc acaacaagaa gttcctgtac 181 aaggacgggc agaaattcga gggaatcacc tactatccca ggacctcgga tcaccaggat 241 ccgcccgtgg agccggcgaa actcttccgg gtgcagcgca tcaagccggt gaagggtaat 301 ccctactggg agaagcgaat cctcaaggat ctgggcctcg atggcaagca gagcgacttc 361 acggtggtca agaacatccc ggagaataac gcgcgcctgt ggaaggtcaa gcacttggtt 421 aaggtcaccc cggtgacgtt tccctacgga gaacccaccg cccaggacgt tcggcacacg 481 atactcaagg agaacggcga gtgcctggtc accagggacc tgggagccat cgagagccgc 541 ctggaggcgc gacgggagta cgatgaacag ccccggcgac tggacaccga cctgctgcgc 601 aaggatgccc gcctcaagtg gctgaatccc tggtagttaa atgcccgttc actttattcc 661 ttaaaatatt ttaaaaaaat acacaaaaaa cacttcgtgg aggaggcatc aca