Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137888 1188 bp mRNA linear INV 09-DEC-2024 (LOC108054808), transcript variant X2, mRNA. ACCESSION XM_017137888 VERSION XM_017137888.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137888.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1188 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1188 /gene="LOC108054808" /note="acidic phospholipase A2 PA4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108054808" CDS 351..1070 /gene="LOC108054808" /codon_start=1 /product="acidic phospholipase A2 PA4 isoform X2" /protein_id="XP_016993377.2" /db_xref="GeneID:108054808" /translation="MREPLPVAVVTVVLLLWFGSAVPPTSGSAVLISDMTMSVMVELS SRHPFCKMHTDRGDIQRMLLQSDPRRIRQVPRESVMELEEVCRRQGSYGHEFRGGLGF IYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTFTRS HCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQERSPCSAHQRAGYNQTEQEAI CAQWQYQPSEKYVPSQPRTSS" misc_feature 654..944 /gene="LOC108054808" /note="A sub-family of Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of...; Region: PLA2_bee_venom_like; cd04704" /db_xref="CDD:153093" misc_feature order(675..677,681..683,687..689,756..758) /gene="LOC108054808" /note="metal binding site [ion binding]; metal-binding site" /db_xref="CDD:153093" misc_feature order(753..755,843..845,909..911) /gene="LOC108054808" /note="catalytic site [active]" /db_xref="CDD:153093" ORIGIN 1 tttcgatttg ttggtgtttt tgttttcatg attttttctt gtcttttttt ggtttttggc 61 caagtccaag tttaacagcg ctcgacgcgc cagaatcaag ttcagttgcg ccgcaaacgc 121 gtcgcggaaa tgtttcgctg ctgctgctgc aaaccgtccc aaagaaatcg aaattgaaat 181 ttcagttgaa atgaattaaa cgaacgcgcc gccgtcctgc aattgaaaga attcctacca 241 aaattcccgc atccttgtca accgttagca aaaaaaaaac cgatacagcg aaacgggaaa 301 ctaacccgtt aaatatttca ctttttcccc taccgttctc agttggcgcc atgagggaac 361 cgctgcccgt ggcggtggtg acggtggtgc tgctcctgtg gttcggctcg gcggtgccac 421 ccacttctgg atccgcggtg ctcatctccg acatgaccat gagcgttatg gtggagctat 481 cctcccgcca tcccttctgc aagatgcaca cagatcgcgg cgatatccag cggatgttgc 541 tgcagtcgga tccgcgtcgc atccgccagg tgccgcgcga gtcggtgatg gagctggagg 601 aggtgtgccg ccggcaggga tcctacggcc acgagttccg cggcggcctg ggcttcatct 661 atccgggtac caagtggtgt ggtccgggca cggcggccac cagctacgac gacctgggcg 721 cccatgctcg cgaggatcgc tgctgtcggg agcacgacat gtgtccggat gtcctcaatg 781 tgggcgagtg ccggcgggga ctgtgcaatc gggggacctt caccaggagc cactgcgact 841 gcgatgctcg attccggcgc tgcctgcagg cggccaacac ggagacggcc aacacgctgg 901 gcgccatatt ctacaatgtg gtgcaggtga cctgcttcca ggagcggagt ccctgctcgg 961 cgcaccagag agccggatac aatcaaacgg agcaggaggc catctgcgcc cagtggcagt 1021 accagccgtc ggagaagtat gtgcccagcc agccgagaac ctcctcttaa acacagaagt 1081 tgacgacctg gaccagctca cggactcatg gaaacggtta caaatctaca aggcactaga 1141 ttatccacta gctgtagtta tcctcgattg caattctcaa acctgaac