Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii acidic phospholipase A2 PA4


LOCUS       XM_017137888            1188 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054808), transcript variant X2, mRNA.
ACCESSION   XM_017137888
VERSION     XM_017137888.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137888.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1188
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1188
                     /gene="LOC108054808"
                     /note="acidic phospholipase A2 PA4; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108054808"
     CDS             351..1070
                     /gene="LOC108054808"
                     /codon_start=1
                     /product="acidic phospholipase A2 PA4 isoform X2"
                     /protein_id="XP_016993377.2"
                     /db_xref="GeneID:108054808"
                     /translation="MREPLPVAVVTVVLLLWFGSAVPPTSGSAVLISDMTMSVMVELS
                     SRHPFCKMHTDRGDIQRMLLQSDPRRIRQVPRESVMELEEVCRRQGSYGHEFRGGLGF
                     IYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTFTRS
                     HCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQERSPCSAHQRAGYNQTEQEAI
                     CAQWQYQPSEKYVPSQPRTSS"
     misc_feature    654..944
                     /gene="LOC108054808"
                     /note="A sub-family of Phospholipase A2, similar to bee
                     venom PLA2. PLA2 is a super-family of secretory and
                     cytosolic enzymes; the latter are either Ca dependent or
                     Ca independent. Enzymatically active PLA2 cleaves the sn-2
                     position of the glycerol backbone of...; Region:
                     PLA2_bee_venom_like; cd04704"
                     /db_xref="CDD:153093"
     misc_feature    order(675..677,681..683,687..689,756..758)
                     /gene="LOC108054808"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153093"
     misc_feature    order(753..755,843..845,909..911)
                     /gene="LOC108054808"
                     /note="catalytic site [active]"
                     /db_xref="CDD:153093"
ORIGIN      
        1 tttcgatttg ttggtgtttt tgttttcatg attttttctt gtcttttttt ggtttttggc
       61 caagtccaag tttaacagcg ctcgacgcgc cagaatcaag ttcagttgcg ccgcaaacgc
      121 gtcgcggaaa tgtttcgctg ctgctgctgc aaaccgtccc aaagaaatcg aaattgaaat
      181 ttcagttgaa atgaattaaa cgaacgcgcc gccgtcctgc aattgaaaga attcctacca
      241 aaattcccgc atccttgtca accgttagca aaaaaaaaac cgatacagcg aaacgggaaa
      301 ctaacccgtt aaatatttca ctttttcccc taccgttctc agttggcgcc atgagggaac
      361 cgctgcccgt ggcggtggtg acggtggtgc tgctcctgtg gttcggctcg gcggtgccac
      421 ccacttctgg atccgcggtg ctcatctccg acatgaccat gagcgttatg gtggagctat
      481 cctcccgcca tcccttctgc aagatgcaca cagatcgcgg cgatatccag cggatgttgc
      541 tgcagtcgga tccgcgtcgc atccgccagg tgccgcgcga gtcggtgatg gagctggagg
      601 aggtgtgccg ccggcaggga tcctacggcc acgagttccg cggcggcctg ggcttcatct
      661 atccgggtac caagtggtgt ggtccgggca cggcggccac cagctacgac gacctgggcg
      721 cccatgctcg cgaggatcgc tgctgtcggg agcacgacat gtgtccggat gtcctcaatg
      781 tgggcgagtg ccggcgggga ctgtgcaatc gggggacctt caccaggagc cactgcgact
      841 gcgatgctcg attccggcgc tgcctgcagg cggccaacac ggagacggcc aacacgctgg
      901 gcgccatatt ctacaatgtg gtgcaggtga cctgcttcca ggagcggagt ccctgctcgg
      961 cgcaccagag agccggatac aatcaaacgg agcaggaggc catctgcgcc cagtggcagt
     1021 accagccgtc ggagaagtat gtgcccagcc agccgagaac ctcctcttaa acacagaagt
     1081 tgacgacctg gaccagctca cggactcatg gaaacggtta caaatctaca aggcactaga
     1141 ttatccacta gctgtagtta tcctcgattg caattctcaa acctgaac