Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137875 900 bp mRNA linear INV 09-DEC-2024 (LOC108054801), mRNA. ACCESSION XM_017137875 VERSION XM_017137875.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137875.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..900 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..900 /gene="LOC108054801" /note="protein Flattop homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054801" CDS 118..900 /gene="LOC108054801" /codon_start=1 /product="protein Flattop homolog" /protein_id="XP_016993364.2" /db_xref="GeneID:108054801" /translation="MAFHFSAQQFEGRFESKRLNNWEYPRFSPPRPRGLKKNAKVVAA NNGHLLPGVKKEGNSFGQYRGTYELPRRITRCFCAHYDACLSGRHKFAGYPRDLCSCQ RENRRALACDQRMTLGQAGDPHWMRQRCQTKCEGLQQIKELHERSERCKRAKCQVVSE KTVLMPPKVCKVACVATEKRRRKRTVTAFARSRPAMHANESTASYEGRHKPYPQPEKP AATSTPGKPKDKPKDKGKDKGKDKEKVKEKGKEKEKISKGHS" misc_feature 121..336 /gene="LOC108054801" /note="protein Flattop and similar proteins; Region: Flattop; cd23705" /db_xref="CDD:467918" misc_feature order(121..153,157..159,166..192,208..213,220..246, 253..255,259..264,274..282,295..324,328..336) /gene="LOC108054801" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:467918" ORIGIN 1 ttgacaaaca gagtgggctg tgcctcgctt ttcatgttca atctgtattt taatgacaaa 61 aaatgtgtac attttgtttt taatttaatt tacaaattct gaagctaaat tttaaggatg 121 gcctttcatt ttagcgccca gcagttcgag ggccgattcg agtcgaagcg cctcaacaat 181 tgggagtacc cgcgcttctc gccgccccgc ccacgaggac tcaagaaaaa cgccaaggtc 241 gtggccgcca acaacggaca cctgctgcct ggagttaaaa aggagggcaa ctcctttggc 301 caatatcgcg ggacctacga acttccccgg cggataacgc gctgcttttg cgcccactac 361 gatgcctgct tgagtgggcg gcacaagttc gccggctatc cgcgtgacct ctgcagctgc 421 cagcgggaga accgccgggc actggcctgc gaccagcgga tgaccttggg ccaggcgggg 481 gatccccact ggatgcgaca gaggtgccag acgaagtgcg agggcctcca gcagatcaag 541 gagctgcacg agcggagcga gcgctgcaag cgggccaagt gccaagtggt gagcgaaaag 601 acggtgttga tgccaccgaa ggtatgcaag gtggcctgtg tggccaccga aaagaggcgt 661 cgcaaacgca cagtcaccgc ttttgcgagg agtcgaccgg cgatgcatgc caacgaatcc 721 acggcatcct acgagggtcg ccacaaaccg tatccgcaac cggagaaacc agcggcaacc 781 tccactcccg gcaaaccgaa ggataagccg aaggataagg gcaaggacaa gggaaaggac 841 aaagagaagg tcaaggaaaa gggcaaggag aaagagaaga tatcgaaggg ccattcgtaa