Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protein Flattop homolog


LOCUS       XM_017137875             900 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054801), mRNA.
ACCESSION   XM_017137875
VERSION     XM_017137875.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137875.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..900
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..900
                     /gene="LOC108054801"
                     /note="protein Flattop homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108054801"
     CDS             118..900
                     /gene="LOC108054801"
                     /codon_start=1
                     /product="protein Flattop homolog"
                     /protein_id="XP_016993364.2"
                     /db_xref="GeneID:108054801"
                     /translation="MAFHFSAQQFEGRFESKRLNNWEYPRFSPPRPRGLKKNAKVVAA
                     NNGHLLPGVKKEGNSFGQYRGTYELPRRITRCFCAHYDACLSGRHKFAGYPRDLCSCQ
                     RENRRALACDQRMTLGQAGDPHWMRQRCQTKCEGLQQIKELHERSERCKRAKCQVVSE
                     KTVLMPPKVCKVACVATEKRRRKRTVTAFARSRPAMHANESTASYEGRHKPYPQPEKP
                     AATSTPGKPKDKPKDKGKDKGKDKEKVKEKGKEKEKISKGHS"
     misc_feature    121..336
                     /gene="LOC108054801"
                     /note="protein Flattop and similar proteins; Region:
                     Flattop; cd23705"
                     /db_xref="CDD:467918"
     misc_feature    order(121..153,157..159,166..192,208..213,220..246,
                     253..255,259..264,274..282,295..324,328..336)
                     /gene="LOC108054801"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467918"
ORIGIN      
        1 ttgacaaaca gagtgggctg tgcctcgctt ttcatgttca atctgtattt taatgacaaa
       61 aaatgtgtac attttgtttt taatttaatt tacaaattct gaagctaaat tttaaggatg
      121 gcctttcatt ttagcgccca gcagttcgag ggccgattcg agtcgaagcg cctcaacaat
      181 tgggagtacc cgcgcttctc gccgccccgc ccacgaggac tcaagaaaaa cgccaaggtc
      241 gtggccgcca acaacggaca cctgctgcct ggagttaaaa aggagggcaa ctcctttggc
      301 caatatcgcg ggacctacga acttccccgg cggataacgc gctgcttttg cgcccactac
      361 gatgcctgct tgagtgggcg gcacaagttc gccggctatc cgcgtgacct ctgcagctgc
      421 cagcgggaga accgccgggc actggcctgc gaccagcgga tgaccttggg ccaggcgggg
      481 gatccccact ggatgcgaca gaggtgccag acgaagtgcg agggcctcca gcagatcaag
      541 gagctgcacg agcggagcga gcgctgcaag cgggccaagt gccaagtggt gagcgaaaag
      601 acggtgttga tgccaccgaa ggtatgcaag gtggcctgtg tggccaccga aaagaggcgt
      661 cgcaaacgca cagtcaccgc ttttgcgagg agtcgaccgg cgatgcatgc caacgaatcc
      721 acggcatcct acgagggtcg ccacaaaccg tatccgcaac cggagaaacc agcggcaacc
      781 tccactcccg gcaaaccgaa ggataagccg aaggataagg gcaaggacaa gggaaaggac
      841 aaagagaagg tcaaggaaaa gggcaaggag aaagagaaga tatcgaaggg ccattcgtaa