Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Helix loop helix protein 4C


LOCUS       XM_017137874             753 bp    mRNA    linear   INV 09-DEC-2024
            (HLH4C), mRNA.
ACCESSION   XM_017137874
VERSION     XM_017137874.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137874.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..753
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..753
                     /gene="HLH4C"
                     /note="Helix loop helix protein 4C; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108054800"
     CDS             143..646
                     /gene="HLH4C"
                     /codon_start=1
                     /product="helix-loop-helix protein 1"
                     /protein_id="XP_016993363.1"
                     /db_xref="GeneID:108054800"
                     /translation="MVYDMTHMAAGPPQSIALSRYYLPDEDEMVGPNNPHLVSEDYAA
                     STTLDVDKRFQARMACETAAQPAPPPPPTPAPRRRTTPIAHLDPSELVGLSREERRRR
                     RRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYL
                     NHVLETP"
     misc_feature    455..637
                     /gene="HLH4C"
                     /note="basic helix-loop-helix (bHLH) domain found in
                     helix-loop-helix protein 1 (HEN-1) and similar proteins;
                     Region: bHLH_TS_HEN1; cd19701"
                     /db_xref="CDD:381544"
     misc_feature    order(470..472,482..484,488..496,500..502,515..517,
                     569..580)
                     /gene="HLH4C"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:381544"
     misc_feature    order(509..514,521..526,530..535,581..583,590..592,
                     602..604,608..613,623..625,629..634)
                     /gene="HLH4C"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381544"
ORIGIN      
        1 taagcgtatc cttcaggcga acagccaaca acagtgaata acaaggatat cttcgagcaa
       61 actttgggat ctatacatac tctgcacctg tgactgctct atcaggagca ggcaaaggaa
      121 aagccaaggg aaaagccaga aaatggtcta tgatatgacc cacatggcgg ctgggccgcc
      181 gcagagcatt gcgctgagtc gctactacct gcccgacgag gacgagatgg tgggcccgaa
      241 caatccgcat ctggtcagcg aggactatgc ggccagcacg accctggatg tcgacaagcg
      301 gttccaggcg cggatggcct gtgagacggc tgcccaaccg gctcctccgc cgccgcccac
      361 gccggcaccc cgccgccgga cgacgcccat cgcccacctg gatccctcgg aactggtggg
      421 cctttcgcgg gaggagcgac gtcgcaggag gagggcaacc cttaaatata ggacagccca
      481 tgcgacgagg gagaggatcc gcgtggaggc cttcaacgta tctttcgccg agctgcgcaa
      541 gctgctgccc actttgccgc cggacaagaa gctctccaag atcgagatcc tcaagctggc
      601 catctgctac attgcctatc tgaatcacgt gctggagacg ccctgagaca gcgccggcgc
      661 ctccagcttc gccaccagct gcctcttcaa cgaggccaac ttcttcgccc ccccgtagga
      721 ggtggggggg cggtgcaccc gagatcggag gtc