Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137874 753 bp mRNA linear INV 09-DEC-2024 (HLH4C), mRNA. ACCESSION XM_017137874 VERSION XM_017137874.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137874.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..753 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..753 /gene="HLH4C" /note="Helix loop helix protein 4C; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054800" CDS 143..646 /gene="HLH4C" /codon_start=1 /product="helix-loop-helix protein 1" /protein_id="XP_016993363.1" /db_xref="GeneID:108054800" /translation="MVYDMTHMAAGPPQSIALSRYYLPDEDEMVGPNNPHLVSEDYAA STTLDVDKRFQARMACETAAQPAPPPPPTPAPRRRTTPIAHLDPSELVGLSREERRRR RRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYL NHVLETP" misc_feature 455..637 /gene="HLH4C" /note="basic helix-loop-helix (bHLH) domain found in helix-loop-helix protein 1 (HEN-1) and similar proteins; Region: bHLH_TS_HEN1; cd19701" /db_xref="CDD:381544" misc_feature order(470..472,482..484,488..496,500..502,515..517, 569..580) /gene="HLH4C" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:381544" misc_feature order(509..514,521..526,530..535,581..583,590..592, 602..604,608..613,623..625,629..634) /gene="HLH4C" /note="putative dimer interface [polypeptide binding]; other site" /db_xref="CDD:381544" ORIGIN 1 taagcgtatc cttcaggcga acagccaaca acagtgaata acaaggatat cttcgagcaa 61 actttgggat ctatacatac tctgcacctg tgactgctct atcaggagca ggcaaaggaa 121 aagccaaggg aaaagccaga aaatggtcta tgatatgacc cacatggcgg ctgggccgcc 181 gcagagcatt gcgctgagtc gctactacct gcccgacgag gacgagatgg tgggcccgaa 241 caatccgcat ctggtcagcg aggactatgc ggccagcacg accctggatg tcgacaagcg 301 gttccaggcg cggatggcct gtgagacggc tgcccaaccg gctcctccgc cgccgcccac 361 gccggcaccc cgccgccgga cgacgcccat cgcccacctg gatccctcgg aactggtggg 421 cctttcgcgg gaggagcgac gtcgcaggag gagggcaacc cttaaatata ggacagccca 481 tgcgacgagg gagaggatcc gcgtggaggc cttcaacgta tctttcgccg agctgcgcaa 541 gctgctgccc actttgccgc cggacaagaa gctctccaag atcgagatcc tcaagctggc 601 catctgctac attgcctatc tgaatcacgt gctggagacg ccctgagaca gcgccggcgc 661 ctccagcttc gccaccagct gcctcttcaa cgaggccaac ttcttcgccc ccccgtagga 721 ggtggggggg cggtgcaccc gagatcggag gtc