Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii alpha-tocopherol transfer protein


LOCUS       XM_017137868            1250 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054795), mRNA.
ACCESSION   XM_017137868
VERSION     XM_017137868.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137868.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1250
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1250
                     /gene="LOC108054795"
                     /note="alpha-tocopherol transfer protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108054795"
     CDS             146..1033
                     /gene="LOC108054795"
                     /codon_start=1
                     /product="alpha-tocopherol transfer protein"
                     /protein_id="XP_016993357.2"
                     /db_xref="GeneID:108054795"
                     /translation="MVQSNEKNEDQLMAKRISDLQEWLKSQPQLPQNISRLLLRRFLH
                     TTRGDPSAAQRLLELNYGLRNKHAHIFIDRDPLDDSSQQLLQVADLVPLPGLTPENNK
                     LLFYRLIDFDADKFNFTAAIKVFFMVADCRFATEDEERLSDGEIPVFDMAGYTLRHLT
                     KTALGALRVYMKFVQEAHPVRLKEIHVLNCPSFVDKVMAVVKPFIKSEVFKLIHFHLP
                     DAETPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRDYLMDVENWQINKTKKNG
                     QRKSSDSGVTQSLRALEID"
     misc_feature    413..862
                     /gene="LOC108054795"
                     /note="Sec14p-like lipid-binding domain; Region: SEC14;
                     cd00170"
                     /db_xref="CDD:469559"
     polyA_site      1250
                     /gene="LOC108054795"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccaagttcca atcagttgca gtcgcgaatt agcgtcgcac agacgcgctg tctcgcttaa
       61 aaataataca caactccgtc tcgctccctc ccggaagtcc gataattccg atagttcttg
      121 tgggtgctag cgataccgct tcaaaatggt ccaatcgaac gagaaaaacg aggatcaact
      181 gatggccaag cggatctcgg atcttcagga gtggctcaag tcgcagccgc aattaccgca
      241 gaatatatcc cgtctgcttc tgcgacgctt tctgcacacg actcgtggcg atccatccgc
      301 cgcccagcgc ctcttggaac tcaattacgg actgcgcaac aagcatgccc acatcttcat
      361 cgatcgcgat cctctggacg acagctctca gcagctgctg caagtcgcag atctggtgcc
      421 gttgcccggt ttgaccccgg aaaacaacaa gctgctcttt taccgcctga tcgactttga
      481 tgcggacaag ttcaacttca cggctgcgat caaggtcttc ttcatggtgg ccgactgtcg
      541 ctttgcgacg gaggacgagg agcgcctgtc ggatggggag atacccgtct tcgacatggc
      601 cggctacacg ctgcgccacc tgaccaaaac cgccctgggt gccctgcgcg tctacatgaa
      661 gttcgtccag gaggcgcatc ccgtgcggct caaggagatc cacgtgctga actgcccctc
      721 gttcgtggac aaggtgatgg ccgtcgtgaa gcccttcatc aagagcgagg tcttcaagct
      781 gatccacttc catctgccgg atgccgagac cccgtatcgt cacttcccgc gctccatgtt
      841 gcccgaggag tacggcggtg aggccgggaa aatgtccgac ctgaagctcc agtggatgca
      901 gttgctcaag gagcagaggg actatctgat ggatgtggag aactggcaga taaacaagac
      961 caaaaagaat ggtcagcgaa agtcgagtga ttcgggcgtt acacaaagtc ttcgagccct
     1021 ggaaatcgat tagtcgccgt gcgcacaact gtacctttgg gtgttttcac attcttctgg
     1081 gttttgcgat ttcccctgag ttaccttttg ggttatagtt acataattcc aattattagc
     1141 ccagaggcac tttttccaaa tcctcgtgaa tgtgaaaatc tattgtattt ctttttgttc
     1201 tcgttttcgt tctacggctc tatgtaaata tacgctatgc ttaaagagaa