Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NADH dehydrogenase (ubiquinone)


LOCUS       XM_017137865             692 bp    mRNA    linear   INV 09-DEC-2024
            B16.6 subunit (ND-B16.6), mRNA.
ACCESSION   XM_017137865
VERSION     XM_017137865.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137865.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..692
                     /gene="ND-B16.6"
                     /note="NADH dehydrogenase (ubiquinone) B16.6 subunit;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108054791"
     CDS             131..595
                     /gene="ND-B16.6"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] 1 alpha
                     subcomplex subunit 13"
                     /protein_id="XP_016993354.1"
                     /db_xref="GeneID:108054791"
                     /translation="MATAVPHCPPKQDLPPPGGYKKIPFARVPPKSYFTGFTMIGSYV
                     AVTAVGLGIYYLTAKKVKRDEIEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAELM
                     KNVPGWEVGTWYGEPVFKTLPEDTLVTPIFKEFYAHSDWKSYAKRAHLKLWS"
     misc_feature    155..550
                     /gene="ND-B16.6"
                     /note="GRIM-19 protein; Region: GRIM-19; pfam06212"
                     /db_xref="CDD:461852"
     polyA_site      692
                     /gene="ND-B16.6"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tataagccaa tcgataacaa cgaaaagtgc gtaatatcga cccactcaca tcactaggtg
       61 ttatgcaaaa tacgtcattt tttgtaactt ttcgactggt tttttcccct taatcgagcg
      121 aggagtcaac atggcgacgg ccgtgccgca ttgccccccg aaacaggacc tgcccccgcc
      181 gggcggctac aagaagatcc ccttcgcccg cgtgccgccc aagagctact tcacaggctt
      241 caccatgatc ggcagctatg tggccgtaac ggccgtcggc ctgggaatct actatctgac
      301 cgccaagaag gtgaagcgcg acgagatcga gatgcgttcc gcccagaatg tgatcttccc
      361 gattttggtc gctgagaggg atcgcgagtt cctgcgccag ctgcgccgaa atagggacga
      421 ggaggccgag ctgatgaaga acgtgcccgg ctgggaggtg ggcacctggt acggcgagcc
      481 cgtcttcaag actctgcccg aggacaccct ggtgacgccg atcttcaagg agttctacgc
      541 ccactccgac tggaagtcgt acgccaagcg tgcccatctg aagctctggt cgtaaatcta
      601 gttaatgcct aagccgcctc ctttttttgt tagtctatat gcgccgcctg agtgctaaaa
      661 tattgcccaa ttataatgtc agattggctg ta