Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137859 656 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017137859 VERSION XM_017137859.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137859.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..656 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..656 /gene="RpL36" /note="ribosomal protein L36; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:108054788" CDS 103..450 /gene="RpL36" /codon_start=1 /product="large ribosomal subunit protein eL36" /protein_id="XP_016993348.1" /db_xref="GeneID:108054788" /translation="MAVRYELAIGLNKGHKTTKIRNVKYTGDKKVKGLRGSRLKNIQT RHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSN ILTQLRKAQTHAK" misc_feature 112..429 /gene="RpL36" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" polyA_site 656 /gene="RpL36" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtaagaaac caaaaaacat cgattgatct gagatatctc caccactatt tcctctccac 61 tttttttcgc tcttttcttc ttttaacagc aactgagtga agatggcagt gcgctacgag 121 ctggcaatcg gtcttaacaa gggccacaag accaccaaga tccggaatgt caagtacacc 181 ggcgacaaga aggtcaaggg tctgcgtgga tctcgcttga agaacatcca aacccgtcac 241 accaagttca tgcgcgatct ggtgcgcgag gtggtgggcc atgcccccta cgagaagcgc 301 accatggagt tgctgaaggt gtccaaggac aagagggccc tgaagttcct caagcgccgc 361 ttgggcaccc acatccgtgc caagaggaag cgcgaggagc tgtccaacat cctcacccag 421 ctgaggaagg cccagaccca cgccaagtaa acggaaccca gccgatagtt cggaatccgg 481 aatcggtatc ggaatcggaa aagcatttgg agcgccgcgt tgtgtttttt atttttttcc 541 ggtgtgaaac acatatatct atatagacca acaataccat atatatgtcg tcgttacttg 601 agagcgagtc taagcatccc agaattaaac aacaaaaaat cttttaaaaa ccacaa