Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ribosomal protein L36 (RpL36),


LOCUS       XM_017137859             656 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017137859
VERSION     XM_017137859.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137859.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..656
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..656
                     /gene="RpL36"
                     /note="ribosomal protein L36; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:108054788"
     CDS             103..450
                     /gene="RpL36"
                     /codon_start=1
                     /product="large ribosomal subunit protein eL36"
                     /protein_id="XP_016993348.1"
                     /db_xref="GeneID:108054788"
                     /translation="MAVRYELAIGLNKGHKTTKIRNVKYTGDKKVKGLRGSRLKNIQT
                     RHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSN
                     ILTQLRKAQTHAK"
     misc_feature    112..429
                     /gene="RpL36"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
     polyA_site      656
                     /gene="RpL36"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtaagaaac caaaaaacat cgattgatct gagatatctc caccactatt tcctctccac
       61 tttttttcgc tcttttcttc ttttaacagc aactgagtga agatggcagt gcgctacgag
      121 ctggcaatcg gtcttaacaa gggccacaag accaccaaga tccggaatgt caagtacacc
      181 ggcgacaaga aggtcaaggg tctgcgtgga tctcgcttga agaacatcca aacccgtcac
      241 accaagttca tgcgcgatct ggtgcgcgag gtggtgggcc atgcccccta cgagaagcgc
      301 accatggagt tgctgaaggt gtccaaggac aagagggccc tgaagttcct caagcgccgc
      361 ttgggcaccc acatccgtgc caagaggaag cgcgaggagc tgtccaacat cctcacccag
      421 ctgaggaagg cccagaccca cgccaagtaa acggaaccca gccgatagtt cggaatccgg
      481 aatcggtatc ggaatcggaa aagcatttgg agcgccgcgt tgtgtttttt atttttttcc
      541 ggtgtgaaac acatatatct atatagacca acaataccat atatatgtcg tcgttacttg
      601 agagcgagtc taagcatccc agaattaaac aacaaaaaat cttttaaaaa ccacaa