Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ribosomal protein S15Aa (RpS15Aa),


LOCUS       XM_017137843             641 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_017137843
VERSION     XM_017137843.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137843.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..641
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..641
                     /gene="RpS15Aa"
                     /note="Ribosomal protein S15Aa; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 16
                     Proteins"
                     /db_xref="GeneID:108054775"
     CDS             57..449
                     /gene="RpS15Aa"
                     /codon_start=1
                     /product="small ribosomal subunit protein uS8A"
                     /protein_id="XP_016993332.1"
                     /db_xref="GeneID:108054775"
                     /translation="MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKH
                     GYIGEFEIVDDHRSGKIVVNLTGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYV
                     VLTTSGGIMDHEEARRKHLGGKILGFFF"
     misc_feature    57..446
                     /gene="RpS15Aa"
                     /note="40S ribosomal protein S15A; Provisional; Region:
                     PTZ00158"
                     /db_xref="CDD:185487"
     polyA_site      641
                     /gene="RpS15Aa"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcccttttc acgtttgccg gtcgtgtaaa tcagtgtttg caaaccaatc ccagccatgg
       61 tgcgtatgaa cgtattggcc gatgccctca agtgcatcaa caacgccgag aagcgcggca
      121 agcgccaggt gctgctgcgt ccctgctcca aggtgatcat caagttcctg accgtgatga
      181 tgaagcacgg ctacatcggc gagttcgaga tcgtcgacga tcaccgctcc ggcaagatcg
      241 tggtcaacct gaccgggcgc ctcaacaagt gcggcgtcat ctcgccccgc ttcgatgtgc
      301 ccatcaacga catcgagaag tggaccaaca atctgctgcc ctcccgccag ttcggctacg
      361 tcgtgctcac cacctcgggc ggcatcatgg accacgagga ggccaggaga aagcatctgg
      421 gaggcaagat cctcggcttc ttcttctagg gccacggcat tttgaaaacg atggggagtt
      481 gatatgtaga ttgacgtttt atttcaccga caaaccatgc atccaaacta cgttttgtat
      541 accacaaacc aggggcgaga acgctgctgc attcattcag acaaccaacg acaatgaatg
      601 ttcacaaaga aacgcgaaat aaaatgattg atacataata a