Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137843 641 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_017137843 VERSION XM_017137843.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137843.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..641 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..641 /gene="RpS15Aa" /note="Ribosomal protein S15Aa; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins" /db_xref="GeneID:108054775" CDS 57..449 /gene="RpS15Aa" /codon_start=1 /product="small ribosomal subunit protein uS8A" /protein_id="XP_016993332.1" /db_xref="GeneID:108054775" /translation="MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKH GYIGEFEIVDDHRSGKIVVNLTGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYV VLTTSGGIMDHEEARRKHLGGKILGFFF" misc_feature 57..446 /gene="RpS15Aa" /note="40S ribosomal protein S15A; Provisional; Region: PTZ00158" /db_xref="CDD:185487" polyA_site 641 /gene="RpS15Aa" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcccttttc acgtttgccg gtcgtgtaaa tcagtgtttg caaaccaatc ccagccatgg 61 tgcgtatgaa cgtattggcc gatgccctca agtgcatcaa caacgccgag aagcgcggca 121 agcgccaggt gctgctgcgt ccctgctcca aggtgatcat caagttcctg accgtgatga 181 tgaagcacgg ctacatcggc gagttcgaga tcgtcgacga tcaccgctcc ggcaagatcg 241 tggtcaacct gaccgggcgc ctcaacaagt gcggcgtcat ctcgccccgc ttcgatgtgc 301 ccatcaacga catcgagaag tggaccaaca atctgctgcc ctcccgccag ttcggctacg 361 tcgtgctcac cacctcgggc ggcatcatgg accacgagga ggccaggaga aagcatctgg 421 gaggcaagat cctcggcttc ttcttctagg gccacggcat tttgaaaacg atggggagtt 481 gatatgtaga ttgacgtttt atttcaccga caaaccatgc atccaaacta cgttttgtat 541 accacaaacc aggggcgaga acgctgctgc attcattcag acaaccaacg acaatgaatg 601 ttcacaaaga aacgcgaaat aaaatgattg atacataata a