Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ribosomal protein S15Aa (RpS15Aa),


LOCUS       XM_017137842             702 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X1, mRNA.
ACCESSION   XM_017137842
VERSION     XM_017137842.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137842.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..702
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..702
                     /gene="RpS15Aa"
                     /note="Ribosomal protein S15Aa; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 16
                     Proteins"
                     /db_xref="GeneID:108054775"
     CDS             118..510
                     /gene="RpS15Aa"
                     /codon_start=1
                     /product="small ribosomal subunit protein uS8A"
                     /protein_id="XP_016993331.1"
                     /db_xref="GeneID:108054775"
                     /translation="MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKH
                     GYIGEFEIVDDHRSGKIVVNLTGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYV
                     VLTTSGGIMDHEEARRKHLGGKILGFFF"
     misc_feature    118..507
                     /gene="RpS15Aa"
                     /note="40S ribosomal protein S15A; Provisional; Region:
                     PTZ00158"
                     /db_xref="CDD:185487"
     polyA_site      702
                     /gene="RpS15Aa"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acttcgcagc caccgggcac actatcctcc gtctctttcc ttccgtttcc ctttcttttc
       61 ccttttcacg tttgcgtgac ggtcgtgtaa atcagtgttt gcaaaccaat cccagccatg
      121 gtgcgtatga acgtattggc cgatgccctc aagtgcatca acaacgccga gaagcgcggc
      181 aagcgccagg tgctgctgcg tccctgctcc aaggtgatca tcaagttcct gaccgtgatg
      241 atgaagcacg gctacatcgg cgagttcgag atcgtcgacg atcaccgctc cggcaagatc
      301 gtggtcaacc tgaccgggcg cctcaacaag tgcggcgtca tctcgccccg cttcgatgtg
      361 cccatcaacg acatcgagaa gtggaccaac aatctgctgc cctcccgcca gttcggctac
      421 gtcgtgctca ccacctcggg cggcatcatg gaccacgagg aggccaggag aaagcatctg
      481 ggaggcaaga tcctcggctt cttcttctag ggccacggca ttttgaaaac gatggggagt
      541 tgatatgtag attgacgttt tatttcaccg acaaaccatg catccaaact acgttttgta
      601 taccacaaac caggggcgag aacgctgctg cattcattca gacaaccaac gacaatgaat
      661 gttcacaaag aaacgcgaaa taaaatgatt gatacataat aa