Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137842 702 bp mRNA linear INV 09-DEC-2024 transcript variant X1, mRNA. ACCESSION XM_017137842 VERSION XM_017137842.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137842.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..702 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..702 /gene="RpS15Aa" /note="Ribosomal protein S15Aa; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins" /db_xref="GeneID:108054775" CDS 118..510 /gene="RpS15Aa" /codon_start=1 /product="small ribosomal subunit protein uS8A" /protein_id="XP_016993331.1" /db_xref="GeneID:108054775" /translation="MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKH GYIGEFEIVDDHRSGKIVVNLTGRLNKCGVISPRFDVPINDIEKWTNNLLPSRQFGYV VLTTSGGIMDHEEARRKHLGGKILGFFF" misc_feature 118..507 /gene="RpS15Aa" /note="40S ribosomal protein S15A; Provisional; Region: PTZ00158" /db_xref="CDD:185487" polyA_site 702 /gene="RpS15Aa" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acttcgcagc caccgggcac actatcctcc gtctctttcc ttccgtttcc ctttcttttc 61 ccttttcacg tttgcgtgac ggtcgtgtaa atcagtgttt gcaaaccaat cccagccatg 121 gtgcgtatga acgtattggc cgatgccctc aagtgcatca acaacgccga gaagcgcggc 181 aagcgccagg tgctgctgcg tccctgctcc aaggtgatca tcaagttcct gaccgtgatg 241 atgaagcacg gctacatcgg cgagttcgag atcgtcgacg atcaccgctc cggcaagatc 301 gtggtcaacc tgaccgggcg cctcaacaag tgcggcgtca tctcgccccg cttcgatgtg 361 cccatcaacg acatcgagaa gtggaccaac aatctgctgc cctcccgcca gttcggctac 421 gtcgtgctca ccacctcggg cggcatcatg gaccacgagg aggccaggag aaagcatctg 481 ggaggcaaga tcctcggctt cttcttctag ggccacggca ttttgaaaac gatggggagt 541 tgatatgtag attgacgttt tatttcaccg acaaaccatg catccaaact acgttttgta 601 taccacaaac caggggcgag aacgctgctg cattcattca gacaaccaac gacaatgaat 661 gttcacaaag aaacgcgaaa taaaatgatt gatacataat aa