PREDICTED: Drosophila takahashii Peroxiredoxin 2 (Prx2), mRNA.

LOCUS       XM_017137841            1008 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017137841
VERSION     XM_017137841.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137841.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1008
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1008
                     /gene="Prx2"
                     /note="Peroxiredoxin 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 20 Proteins"
                     /db_xref="GeneID:108054773"
     CDS             161..745
                     /gene="Prx2"
                     /codon_start=1
                     /product="peroxiredoxin 2"
                     /protein_id="XP_016993330.1"
                     /db_xref="GeneID:108054773"
                     /translation="MPQLQKSAPEFSGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFT
                     FVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLAD
                     KSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQY
                     TDKYGEVCPANWKPGKKTMVADPTKSKEYFETTS"
     misc_feature    170..685
                     /gene="Prx2"
                     /note="Peroxiredoxin (PRX) family, Typical 2-Cys PRX
                     subfamily; PRXs are thiol-specific antioxidant (TSA)
                     proteins, which confer a protective role in cells through
                     its peroxidase activity by reducing hydrogen peroxide,
                     peroxynitrite, and organic hydroperoxides; Region:
                     PRX_Typ2cys; cd03015"
                     /db_xref="CDD:239313"
     misc_feature    order(170..172,293..298,305..307,494..496,524..526,
                     563..571,575..583,593..598,617..619,662..673)
                     /gene="Prx2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239313"
     misc_feature    order(287..289,389..394,467..469,473..475,509..511)
                     /gene="Prx2"
                     /note="decamer (pentamer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239313"
     misc_feature    order(290..292,299..301,527..529)
                     /gene="Prx2"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239313"
     misc_feature    order(299..301,662..664)
                     /gene="Prx2"
                     /note="peroxidatic and resolving cysteines [active]"
                     /db_xref="CDD:239313"
     polyA_site      1008
                     /gene="Prx2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcttttcaaa ttaaggcaaa aacaattgag tcgaacagtt gagaacccat ttcattcgcg
       61 aacttgtgcc gaaacgttgt gcaaaagccg ctgctgcgag aatcagataa cccacgcgga
      121 agtcgagcaa ttaccgagtt taccaagaaa attaactaaa atgccccagc tacagaagag
      181 cgctcccgaa ttctccggca ccgccgtcgt caacggcgtg ttcaaggaca tcaagctgag
      241 cgactacaag ggcaagtacc tggtgctgtt cttctacccg ctggacttca ccttcgtgtg
      301 tcccacggag atcatcgcct tctcggagag cgccgccgag ttccgcaaga tcaactgcga
      361 ggtgatcggc tgctccacgg acagccagtt cacccatctg gcctggatca acacgccccg
      421 gaagcagggt ggtttgggca gcatggacat tcccctgctg gccgacaagt cgatgaaggt
      481 ggcccgcgac tacggagtgc tggacgagga gaccggcatc cccttccgcg ggctcttcat
      541 catcgacgac aagcagaact tgcgccagat caccgtgaac gatctgcccg tgggccgcag
      601 cgtggaggag accctgcgct tggtccaggc cttccagtac accgacaagt acggcgaggt
      661 ctgcccggcc aactggaagc ccggcaagaa gaccatggtg gccgatccca ccaagtccaa
      721 ggagtacttc gagaccacct cctaaagagg ctagctgctt gatgggcggg gggctgctcc
      781 tggcgagcgg gagcggattc gaatcgcaac cccctcgcct acatattaca tatatcctac
      841 atattaaccc tagagcgtag agagaagaag atgaaactgt gaaactgtcg cctttcccct
      901 gcaacaacca actagaaacc agaaacacct gcagaagcta agcggaaagt gatttatttt
      961 tgtgcttttt tttgtaattc accacaataa acgaaggaaa aaaagaaa