PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017137800             606 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054736), mRNA.
ACCESSION   XM_017137800
VERSION     XM_017137800.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017137800.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 34% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..606
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..606
                     /gene="LOC108054736"
                     /note="uncharacterized LOC108054736; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108054736"
     CDS             1..606
                     /gene="LOC108054736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016993289.2"
                     /db_xref="GeneID:108054736"
                     /translation="MKSFLGIVLIAVVSGTNRTTTRKPTTIESIVIRVPPPRPLCILP
                     PQCTLRSPRVCGRHPNGDCQRFRNICDLLALNRRRNPLQVIHTRELDCRGIRGVGEAS
                     RRPCYYPCPARPVICKRTPPEAEICVRSRNLHSCKLLANNCQLRNQNCHSQPRKNWHR
                     TDRRRCGRRQVGDKPDVCEKLPVPNTAVPITTRRPTTKASV"
ORIGIN      
        1 atgaaatcat ttttagggat tgtcctcatt gcggtggtta gtggcaccaa taggacaacc
       61 accagaaagc ccactaccat tgagtccatt gtgatccgag tcccaccgcc ccgcccactt
      121 tgcattctcc cgccccaatg cacgcttcga agtccgcgag tctgtggtcg tcaccccaat
      181 ggggactgcc agcgtttccg gaacatttgc gacctgctgg ccctgaatcg ccggcgaaac
      241 cccctgcagg tgattcacac ccgggagctg gactgccgag gaattcgagg cgtgggcgaa
      301 gcgagccggc gaccttgcta ctacccttgt cccgctcgtc cggttatttg caaaagaacg
      361 ccccccgagg cggagatctg cgttcggtcg cgaaatttgc atagctgcaa gctgctggcc
      421 aacaattgtc agctgcgcaa ccagaattgc cacagccaac ccagaaaaaa ctggcaccgc
      481 accgatagac ggcgatgtgg gcgacggcag gtgggggata agccagatgt ctgtgagaaa
      541 ctgcccgttc cgaacactgc tgtcccaata acgacccgca gacccaccac caaggcctct
      601 gtataa