Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii CTD nuclear envelope phosphatase 1


LOCUS       XM_017137798             686 bp    mRNA    linear   INV 09-DEC-2024
            regulatory subunit 1 (Cnep1r1), mRNA.
ACCESSION   XM_017137798
VERSION     XM_017137798.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137798.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..686
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..686
                     /gene="Cnep1r1"
                     /note="CTD nuclear envelope phosphatase 1 regulatory
                     subunit 1; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108054734"
     CDS             231..602
                     /gene="Cnep1r1"
                     /codon_start=1
                     /product="nuclear envelope phosphatase-regulatory subunit
                     1 homolog"
                     /protein_id="XP_016993287.2"
                     /db_xref="GeneID:108054734"
                     /translation="MEDPEAEDLRAFERRLAEVVTAEKPSSFRWRLVLGAIFACSAIS
                     ACHWMRVAKESESLVFRILSSHSAFAFSLATVCLLIMYGFNHAAKQDPAILRDTREML
                     SPFRLNCDNQGRLIPFPPPTE"
     misc_feature    240..593
                     /gene="Cnep1r1"
                     /note="Transmembrane protein 188; Region: Tmemb_18A;
                     pfam09771"
                     /db_xref="CDD:401646"
ORIGIN      
        1 tttcttttaa attcatagtt taactaaatc tcattttcga acagattttg tctgtagcca
       61 aaggtgttta tttaattttt aggttgtttg atatttagtg tcccagtcaa aattcagcag
      121 atgatgcgaa cttaatgccg ctgtcttgta catttattac tcacgaggct atcggctaac
      181 caggatccag ggcttcgcat tggagtcagg gagattcctc tagtcacgga atggaggacc
      241 ctgaggcaga ggacttgcgg gccttcgagc gccggctagc ggaggtagtc actgcagaaa
      301 agccgagctc cttccgctgg cgcctcgtac tgggcgcgat tttcgcctgc tcggcgatca
      361 gcgcctgcca ctggatgcga gttgccaagg agagcgagtc actggtattc cgaatcctgt
      421 ccagccacag cgcattcgcc ttctccttgg cgactgtatg cctgttaatc atgtacggat
      481 ttaatcacgc cgccaagcag gatcccgcca ttctgcggga cacccgggaa atgctttctc
      541 ctttccgtct taactgcgac aaccagggcc gtcttatccc gttcccaccg cccaccgagt
      601 agctggacat acgtcattaa taacacgctc aaattgactc tgttgaaata gttgctagtc
      661 aaataaacaa tcccctatac aaaata