Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137798 686 bp mRNA linear INV 09-DEC-2024 regulatory subunit 1 (Cnep1r1), mRNA. ACCESSION XM_017137798 VERSION XM_017137798.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137798.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..686 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..686 /gene="Cnep1r1" /note="CTD nuclear envelope phosphatase 1 regulatory subunit 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108054734" CDS 231..602 /gene="Cnep1r1" /codon_start=1 /product="nuclear envelope phosphatase-regulatory subunit 1 homolog" /protein_id="XP_016993287.2" /db_xref="GeneID:108054734" /translation="MEDPEAEDLRAFERRLAEVVTAEKPSSFRWRLVLGAIFACSAIS ACHWMRVAKESESLVFRILSSHSAFAFSLATVCLLIMYGFNHAAKQDPAILRDTREML SPFRLNCDNQGRLIPFPPPTE" misc_feature 240..593 /gene="Cnep1r1" /note="Transmembrane protein 188; Region: Tmemb_18A; pfam09771" /db_xref="CDD:401646" ORIGIN 1 tttcttttaa attcatagtt taactaaatc tcattttcga acagattttg tctgtagcca 61 aaggtgttta tttaattttt aggttgtttg atatttagtg tcccagtcaa aattcagcag 121 atgatgcgaa cttaatgccg ctgtcttgta catttattac tcacgaggct atcggctaac 181 caggatccag ggcttcgcat tggagtcagg gagattcctc tagtcacgga atggaggacc 241 ctgaggcaga ggacttgcgg gccttcgagc gccggctagc ggaggtagtc actgcagaaa 301 agccgagctc cttccgctgg cgcctcgtac tgggcgcgat tttcgcctgc tcggcgatca 361 gcgcctgcca ctggatgcga gttgccaagg agagcgagtc actggtattc cgaatcctgt 421 ccagccacag cgcattcgcc ttctccttgg cgactgtatg cctgttaatc atgtacggat 481 ttaatcacgc cgccaagcag gatcccgcca ttctgcggga cacccgggaa atgctttctc 541 ctttccgtct taactgcgac aaccagggcc gtcttatccc gttcccaccg cccaccgagt 601 agctggacat acgtcattaa taacacgctc aaattgactc tgttgaaata gttgctagtc 661 aaataaacaa tcccctatac aaaata