Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii farnesol dehydrogenase


LOCUS       XM_017137796             868 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054732), mRNA.
ACCESSION   XM_017137796
VERSION     XM_017137796.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137796.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..868
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..868
                     /gene="LOC108054732"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:108054732"
     CDS             59..802
                     /gene="LOC108054732"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_016993285.2"
                     /db_xref="GeneID:108054732"
                     /translation="MDRWQDRVAVITGASSGIGAAVARQLVSAGVIVVGLARRVDRMD
                     AIKEELPPELQTRMHTIHCDVGNLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLT
                     LELEQLQQVLNVNLMGVVICTRRAFRSMQQREVAGHVVLINSLTGRTIINPPGDELQL
                     LNMYPLTKHGITALLEILRQELRGFKTKIKVTSITPGVTDTEILPTGYDTLPMLKPDD
                     IAAGIMYALATPPHVQVHELTIKPLGEPF"
     misc_feature    59..784
                     /gene="LOC108054732"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(95..97,101..106,110..112,167..175,329..337,482..490,
                     548..550,560..562,644..655)
                     /gene="LOC108054732"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(401..403,488..490,548..550,560..562)
                     /gene="LOC108054732"
                     /note="active site"
                     /db_xref="CDD:187535"
     polyA_site      868
                     /gene="LOC108054732"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggacagcttg atagctgact gttacaatcc aactatttaa cacgagaaaa actaagagat
       61 ggatcgctgg caggatcgcg tagcggtgat cacgggtgcc agttccggga ttggagctgc
      121 cgtggcccgc caactggtga gtgctggtgt cattgttgtg ggtctggctc ggcgggtgga
      181 ccgcatggat gccattaagg aagaactgcc accggagctg cagacccgaa tgcataccat
      241 ccactgtgat gtcggaaacc tggactcggt gacggcagcc tttgactgga tcgaggagca
      301 gctgggcggt tgtgacatcc tggtgaacaa cgccggctgc ctcaaccccg gacaactgct
      361 caccctggag ctcgagcaac tgcagcaggt tttgaacgtg aacctgatgg gcgtggtcat
      421 ctgcacgcgg cgcgcttttc gctcgatgca gcaacgtgag gtggcaggtc atgtggtgct
      481 catcaatagt ctaacgggac gaaccatcat caatccacca ggcgacgaat tgcagttgct
      541 caacatgtat ccgctaacaa agcacgggat tacggccttg ttggagattc tgcggcagga
      601 gctgcgcgga tttaagacca aaatcaaggt tacgagcatc actccaggag tgaccgatac
      661 ggagattctg cctactggtt acgatacgtt gccgatgctt aaaccggatg acatcgccgc
      721 gggtattatg tatgccctgg ccactccccc gcatgtccaa gtgcacgaac tgaccatcaa
      781 gccgctggga gagcctttct aaatccgtcc gggaatatta ttataatgat gaagagatcg
      841 ttttcagcaa atatagcgat gcctgaaa