Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137796 868 bp mRNA linear INV 09-DEC-2024 (LOC108054732), mRNA. ACCESSION XM_017137796 VERSION XM_017137796.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137796.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..868 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..868 /gene="LOC108054732" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108054732" CDS 59..802 /gene="LOC108054732" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_016993285.2" /db_xref="GeneID:108054732" /translation="MDRWQDRVAVITGASSGIGAAVARQLVSAGVIVVGLARRVDRMD AIKEELPPELQTRMHTIHCDVGNLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLT LELEQLQQVLNVNLMGVVICTRRAFRSMQQREVAGHVVLINSLTGRTIINPPGDELQL LNMYPLTKHGITALLEILRQELRGFKTKIKVTSITPGVTDTEILPTGYDTLPMLKPDD IAAGIMYALATPPHVQVHELTIKPLGEPF" misc_feature 59..784 /gene="LOC108054732" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(95..97,101..106,110..112,167..175,329..337,482..490, 548..550,560..562,644..655) /gene="LOC108054732" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(401..403,488..490,548..550,560..562) /gene="LOC108054732" /note="active site" /db_xref="CDD:187535" polyA_site 868 /gene="LOC108054732" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggacagcttg atagctgact gttacaatcc aactatttaa cacgagaaaa actaagagat 61 ggatcgctgg caggatcgcg tagcggtgat cacgggtgcc agttccggga ttggagctgc 121 cgtggcccgc caactggtga gtgctggtgt cattgttgtg ggtctggctc ggcgggtgga 181 ccgcatggat gccattaagg aagaactgcc accggagctg cagacccgaa tgcataccat 241 ccactgtgat gtcggaaacc tggactcggt gacggcagcc tttgactgga tcgaggagca 301 gctgggcggt tgtgacatcc tggtgaacaa cgccggctgc ctcaaccccg gacaactgct 361 caccctggag ctcgagcaac tgcagcaggt tttgaacgtg aacctgatgg gcgtggtcat 421 ctgcacgcgg cgcgcttttc gctcgatgca gcaacgtgag gtggcaggtc atgtggtgct 481 catcaatagt ctaacgggac gaaccatcat caatccacca ggcgacgaat tgcagttgct 541 caacatgtat ccgctaacaa agcacgggat tacggccttg ttggagattc tgcggcagga 601 gctgcgcgga tttaagacca aaatcaaggt tacgagcatc actccaggag tgaccgatac 661 ggagattctg cctactggtt acgatacgtt gccgatgctt aaaccggatg acatcgccgc 721 gggtattatg tatgccctgg ccactccccc gcatgtccaa gtgcacgaac tgaccatcaa 781 gccgctggga gagcctttct aaatccgtcc gggaatatta ttataatgat gaagagatcg 841 ttttcagcaa atatagcgat gcctgaaa