Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii myb/SANT-like DNA-binding


LOCUS       XM_017137793             423 bp    mRNA    linear   INV 09-DEC-2024
            domain-containing protein 3 (LOC108054730), mRNA.
ACCESSION   XM_017137793
VERSION     XM_017137793.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017137793.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..423
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..423
                     /gene="LOC108054730"
                     /note="myb/SANT-like DNA-binding domain-containing protein
                     3; Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 13 Proteins"
                     /db_xref="GeneID:108054730"
     CDS             1..423
                     /gene="LOC108054730"
                     /codon_start=1
                     /product="myb/SANT-like DNA-binding domain-containing
                     protein 3"
                     /protein_id="XP_016993282.2"
                     /db_xref="GeneID:108054730"
                     /translation="MSERKVRGKTFSLLEEHIPIDLVDSMKHILENKKSDADTWKEKA
                     DAWERLAEKFAAQSGIERTWKTLRDKYDHLNKKTRSEFAAEKLERYRTGGGVASSTSV
                     SAISEKIGAIIQTASTLDSFNNVYNNFLICSISTFDRR"
     misc_feature    19..249
                     /gene="LOC108054730"
                     /note="Myb/SANT-like DNA-binding domain; Region:
                     Myb_DNA-bind_5; pfam13873"
                     /db_xref="CDD:433544"
ORIGIN      
        1 atgtcggaaa ggaaagttcg tggaaaaacc ttttcattgt tggaggagca tatccccatt
       61 gatcttgtgg atagtatgaa gcacattttg gaaaataaga agagtgatgc cgatacctgg
      121 aaggagaaag cagatgcctg ggaacgtctt gctgagaaat tcgctgccca atctggaata
      181 gagcggacgt ggaaaacatt gagggacaaa tatgaccacc taaataagaa aacccgaagt
      241 gaatttgctg ccgagaagct cgaaagatac cgcactggtg gaggagtcgc gtcttccact
      301 tctgtttccg caatctccga aaagatagga gccataatcc aaacggcaag tacgctggat
      361 agttttaata acgtttataa taactttcta atctgcagca tatctacgtt cgatcgacga
      421 taa