Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137793 423 bp mRNA linear INV 09-DEC-2024 domain-containing protein 3 (LOC108054730), mRNA. ACCESSION XM_017137793 VERSION XM_017137793.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017137793.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..423 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..423 /gene="LOC108054730" /note="myb/SANT-like DNA-binding domain-containing protein 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:108054730" CDS 1..423 /gene="LOC108054730" /codon_start=1 /product="myb/SANT-like DNA-binding domain-containing protein 3" /protein_id="XP_016993282.2" /db_xref="GeneID:108054730" /translation="MSERKVRGKTFSLLEEHIPIDLVDSMKHILENKKSDADTWKEKA DAWERLAEKFAAQSGIERTWKTLRDKYDHLNKKTRSEFAAEKLERYRTGGGVASSTSV SAISEKIGAIIQTASTLDSFNNVYNNFLICSISTFDRR" misc_feature 19..249 /gene="LOC108054730" /note="Myb/SANT-like DNA-binding domain; Region: Myb_DNA-bind_5; pfam13873" /db_xref="CDD:433544" ORIGIN 1 atgtcggaaa ggaaagttcg tggaaaaacc ttttcattgt tggaggagca tatccccatt 61 gatcttgtgg atagtatgaa gcacattttg gaaaataaga agagtgatgc cgatacctgg 121 aaggagaaag cagatgcctg ggaacgtctt gctgagaaat tcgctgccca atctggaata 181 gagcggacgt ggaaaacatt gagggacaaa tatgaccacc taaataagaa aacccgaagt 241 gaatttgctg ccgagaagct cgaaagatac cgcactggtg gaggagtcgc gtcttccact 301 tctgtttccg caatctccga aaagatagga gccataatcc aaacggcaag tacgctggat 361 agttttaata acgtttataa taactttcta atctgcagca tatctacgtt cgatcgacga 421 taa