PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017137768             279 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108054708), mRNA.
ACCESSION   XM_017137768
VERSION     XM_017137768.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137768.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio   :: 23% of CDS bases
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-64                JARPSC010000001.1  7987855-7987918     c
            65-102              JARPSC010000001.1  7987254-7987291     c
            103-279             JARPSC010000001.1  7987075-7987251     c
FEATURES             Location/Qualifiers
     source          1..279
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..279
                     /gene="LOC108054708"
                     /note="uncharacterized LOC108054708; The sequence of the
                     model RefSeq transcript was modified relative to its
                     source genomic sequence to represent the inferred CDS:
                     deleted 2 bases in 1 codon; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108054708"
     CDS             1..279
                     /gene="LOC108054708"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 2 bases in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: uncharacterized protein"
                     /protein_id="XP_016993257.3"
                     /db_xref="GeneID:108054708"
                     /translation="MTDPPATVVKVHWPSARIAETVSLVPGHSHYRCMMCREVTAPHG
                     CVRSSLFLVRAKIQQLQKLKLLPLAVVATHRNIERKLSDMKMKIVKMK"
ORIGIN      
        1 atgaccgacc caccggccac agtggtcaag gtccattggc catcggcgcg aattgctgaa
       61 accgtctctc tggtccctgg tcattcacat tatcgttgca tgatgtgccg agaggtaacc
      121 gcgccgcatg ggtgtgttcg ttcatcttta tttcttgtgc gtgcaaaaat tcaacaattg
      181 cagaaattga aacttttgcc tcttgccgtt gttgccacac acagaaacat tgaaagaaaa
      241 ctttcagaca tgaaaatgaa aatcgtaaaa atgaaataa